Cargando…

A high-density intraspecific SNP linkage map of pigeonpea (Cajanas cajan L. Millsp.)

Pigeonpea (Cajanus cajan (L.) Millsp.) is a major food legume cultivated in semi-arid tropical regions including the Indian subcontinent, Africa, and Southeast Asia. It is an important source of protein, minerals, and vitamins for nearly 20% of the world population. Due to high carbon sequestration...

Descripción completa

Detalles Bibliográficos
Autores principales: Arora, Sheetal, Mahato, Ajay Kumar, Singh, Sangeeta, Mandal, Paritra, Bhutani, Shefali, Dutta, Sutapa, Kumawat, Giriraj, Singh, Bikram Pratap, Chaudhary, A. K., Yadav, Rekha, Gaikwad, K., Sevanthi, Amitha Mithra, Datta, Subhojit, Raje, Ranjeet S., Sharma, Tilak R., Singh, Nagendra Kumar
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Public Library of Science 2017
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5487049/
https://www.ncbi.nlm.nih.gov/pubmed/28654689
http://dx.doi.org/10.1371/journal.pone.0179747
_version_ 1783246380253315072
author Arora, Sheetal
Mahato, Ajay Kumar
Singh, Sangeeta
Mandal, Paritra
Bhutani, Shefali
Dutta, Sutapa
Kumawat, Giriraj
Singh, Bikram Pratap
Chaudhary, A. K.
Yadav, Rekha
Gaikwad, K.
Sevanthi, Amitha Mithra
Datta, Subhojit
Raje, Ranjeet S.
Sharma, Tilak R.
Singh, Nagendra Kumar
author_facet Arora, Sheetal
Mahato, Ajay Kumar
Singh, Sangeeta
Mandal, Paritra
Bhutani, Shefali
Dutta, Sutapa
Kumawat, Giriraj
Singh, Bikram Pratap
Chaudhary, A. K.
Yadav, Rekha
Gaikwad, K.
Sevanthi, Amitha Mithra
Datta, Subhojit
Raje, Ranjeet S.
Sharma, Tilak R.
Singh, Nagendra Kumar
author_sort Arora, Sheetal
collection PubMed
description Pigeonpea (Cajanus cajan (L.) Millsp.) is a major food legume cultivated in semi-arid tropical regions including the Indian subcontinent, Africa, and Southeast Asia. It is an important source of protein, minerals, and vitamins for nearly 20% of the world population. Due to high carbon sequestration and drought tolerance, pigeonpea is an important crop for the development of climate resilient agriculture and nutritional security. However, pigeonpea productivity has remained low for decades because of limited genetic and genomic resources, and sparse utilization of landraces and wild pigeonpea germplasm. Here, we present a dense intraspecific linkage map of pigeonpea comprising 932 markers that span a total adjusted map length of 1,411.83 cM. The consensus map is based on three different linkage maps that incorporate a large number of single nucleotide polymorphism (SNP) markers derived from next generation sequencing data, using Illumina GoldenGate bead arrays, and genotyping with restriction site associated DNA (RAD) sequencing. The genotyping-by-sequencing enhanced the marker density but was met with limited success due to lack of common markers across the genotypes of mapping population. The integrated map has 547 bead-array SNP, 319 RAD-SNP, and 65 simple sequence repeat (SSR) marker loci. We also show here correspondence between our linkage map and published genome pseudomolecules of pigeonpea. The availability of a high-density linkage map will help improve the anchoring of the pigeonpea genome to its chromosomes and the mapping of genes and quantitative trait loci associated with useful agronomic traits.
format Online
Article
Text
id pubmed-5487049
institution National Center for Biotechnology Information
language English
publishDate 2017
publisher Public Library of Science
record_format MEDLINE/PubMed
spelling pubmed-54870492017-07-11 A high-density intraspecific SNP linkage map of pigeonpea (Cajanas cajan L. Millsp.) Arora, Sheetal Mahato, Ajay Kumar Singh, Sangeeta Mandal, Paritra Bhutani, Shefali Dutta, Sutapa Kumawat, Giriraj Singh, Bikram Pratap Chaudhary, A. K. Yadav, Rekha Gaikwad, K. Sevanthi, Amitha Mithra Datta, Subhojit Raje, Ranjeet S. Sharma, Tilak R. Singh, Nagendra Kumar PLoS One Research Article Pigeonpea (Cajanus cajan (L.) Millsp.) is a major food legume cultivated in semi-arid tropical regions including the Indian subcontinent, Africa, and Southeast Asia. It is an important source of protein, minerals, and vitamins for nearly 20% of the world population. Due to high carbon sequestration and drought tolerance, pigeonpea is an important crop for the development of climate resilient agriculture and nutritional security. However, pigeonpea productivity has remained low for decades because of limited genetic and genomic resources, and sparse utilization of landraces and wild pigeonpea germplasm. Here, we present a dense intraspecific linkage map of pigeonpea comprising 932 markers that span a total adjusted map length of 1,411.83 cM. The consensus map is based on three different linkage maps that incorporate a large number of single nucleotide polymorphism (SNP) markers derived from next generation sequencing data, using Illumina GoldenGate bead arrays, and genotyping with restriction site associated DNA (RAD) sequencing. The genotyping-by-sequencing enhanced the marker density but was met with limited success due to lack of common markers across the genotypes of mapping population. The integrated map has 547 bead-array SNP, 319 RAD-SNP, and 65 simple sequence repeat (SSR) marker loci. We also show here correspondence between our linkage map and published genome pseudomolecules of pigeonpea. The availability of a high-density linkage map will help improve the anchoring of the pigeonpea genome to its chromosomes and the mapping of genes and quantitative trait loci associated with useful agronomic traits. Public Library of Science 2017-06-27 /pmc/articles/PMC5487049/ /pubmed/28654689 http://dx.doi.org/10.1371/journal.pone.0179747 Text en © 2017 Arora et al http://creativecommons.org/licenses/by/4.0/ This is an open access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/) , which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited.
spellingShingle Research Article
Arora, Sheetal
Mahato, Ajay Kumar
Singh, Sangeeta
Mandal, Paritra
Bhutani, Shefali
Dutta, Sutapa
Kumawat, Giriraj
Singh, Bikram Pratap
Chaudhary, A. K.
Yadav, Rekha
Gaikwad, K.
Sevanthi, Amitha Mithra
Datta, Subhojit
Raje, Ranjeet S.
Sharma, Tilak R.
Singh, Nagendra Kumar
A high-density intraspecific SNP linkage map of pigeonpea (Cajanas cajan L. Millsp.)
title A high-density intraspecific SNP linkage map of pigeonpea (Cajanas cajan L. Millsp.)
title_full A high-density intraspecific SNP linkage map of pigeonpea (Cajanas cajan L. Millsp.)
title_fullStr A high-density intraspecific SNP linkage map of pigeonpea (Cajanas cajan L. Millsp.)
title_full_unstemmed A high-density intraspecific SNP linkage map of pigeonpea (Cajanas cajan L. Millsp.)
title_short A high-density intraspecific SNP linkage map of pigeonpea (Cajanas cajan L. Millsp.)
title_sort high-density intraspecific snp linkage map of pigeonpea (cajanas cajan l. millsp.)
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5487049/
https://www.ncbi.nlm.nih.gov/pubmed/28654689
http://dx.doi.org/10.1371/journal.pone.0179747
work_keys_str_mv AT arorasheetal ahighdensityintraspecificsnplinkagemapofpigeonpeacajanascajanlmillsp
AT mahatoajaykumar ahighdensityintraspecificsnplinkagemapofpigeonpeacajanascajanlmillsp
AT singhsangeeta ahighdensityintraspecificsnplinkagemapofpigeonpeacajanascajanlmillsp
AT mandalparitra ahighdensityintraspecificsnplinkagemapofpigeonpeacajanascajanlmillsp
AT bhutanishefali ahighdensityintraspecificsnplinkagemapofpigeonpeacajanascajanlmillsp
AT duttasutapa ahighdensityintraspecificsnplinkagemapofpigeonpeacajanascajanlmillsp
AT kumawatgiriraj ahighdensityintraspecificsnplinkagemapofpigeonpeacajanascajanlmillsp
AT singhbikrampratap ahighdensityintraspecificsnplinkagemapofpigeonpeacajanascajanlmillsp
AT chaudharyak ahighdensityintraspecificsnplinkagemapofpigeonpeacajanascajanlmillsp
AT yadavrekha ahighdensityintraspecificsnplinkagemapofpigeonpeacajanascajanlmillsp
AT gaikwadk ahighdensityintraspecificsnplinkagemapofpigeonpeacajanascajanlmillsp
AT sevanthiamithamithra ahighdensityintraspecificsnplinkagemapofpigeonpeacajanascajanlmillsp
AT dattasubhojit ahighdensityintraspecificsnplinkagemapofpigeonpeacajanascajanlmillsp
AT rajeranjeets ahighdensityintraspecificsnplinkagemapofpigeonpeacajanascajanlmillsp
AT sharmatilakr ahighdensityintraspecificsnplinkagemapofpigeonpeacajanascajanlmillsp
AT singhnagendrakumar ahighdensityintraspecificsnplinkagemapofpigeonpeacajanascajanlmillsp
AT arorasheetal highdensityintraspecificsnplinkagemapofpigeonpeacajanascajanlmillsp
AT mahatoajaykumar highdensityintraspecificsnplinkagemapofpigeonpeacajanascajanlmillsp
AT singhsangeeta highdensityintraspecificsnplinkagemapofpigeonpeacajanascajanlmillsp
AT mandalparitra highdensityintraspecificsnplinkagemapofpigeonpeacajanascajanlmillsp
AT bhutanishefali highdensityintraspecificsnplinkagemapofpigeonpeacajanascajanlmillsp
AT duttasutapa highdensityintraspecificsnplinkagemapofpigeonpeacajanascajanlmillsp
AT kumawatgiriraj highdensityintraspecificsnplinkagemapofpigeonpeacajanascajanlmillsp
AT singhbikrampratap highdensityintraspecificsnplinkagemapofpigeonpeacajanascajanlmillsp
AT chaudharyak highdensityintraspecificsnplinkagemapofpigeonpeacajanascajanlmillsp
AT yadavrekha highdensityintraspecificsnplinkagemapofpigeonpeacajanascajanlmillsp
AT gaikwadk highdensityintraspecificsnplinkagemapofpigeonpeacajanascajanlmillsp
AT sevanthiamithamithra highdensityintraspecificsnplinkagemapofpigeonpeacajanascajanlmillsp
AT dattasubhojit highdensityintraspecificsnplinkagemapofpigeonpeacajanascajanlmillsp
AT rajeranjeets highdensityintraspecificsnplinkagemapofpigeonpeacajanascajanlmillsp
AT sharmatilakr highdensityintraspecificsnplinkagemapofpigeonpeacajanascajanlmillsp
AT singhnagendrakumar highdensityintraspecificsnplinkagemapofpigeonpeacajanascajanlmillsp