Cargando…

Telephone consultations for general practice: a systematic review

BACKGROUND: The use of information technology, including internet- and telephone-based resources, is becoming an alternative and supporting method of providing many forms of services in a healthcare and health management setting. Telephone consultations provide a promising alternative and supporting...

Descripción completa

Detalles Bibliográficos
Autores principales: Downes, Martin J, Mervin, Merehau C, Byrnes, Joshua M, Scuffham, Paul A
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2017
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5496327/
https://www.ncbi.nlm.nih.gov/pubmed/28673333
http://dx.doi.org/10.1186/s13643-017-0529-0
_version_ 1783247954573787136
author Downes, Martin J
Mervin, Merehau C
Byrnes, Joshua M
Scuffham, Paul A
author_facet Downes, Martin J
Mervin, Merehau C
Byrnes, Joshua M
Scuffham, Paul A
author_sort Downes, Martin J
collection PubMed
description BACKGROUND: The use of information technology, including internet- and telephone-based resources, is becoming an alternative and supporting method of providing many forms of services in a healthcare and health management setting. Telephone consultations provide a promising alternative and supporting service for face-to-face general practice care. The aim of this review is to utilize a systematic review to collate evidence on the use of telephone consultation as an alternative to face-to-face general practice visits. METHODS: A systematic search of MEDLINE, CINAHL, The Cochrane Library, and the International Clinical Trials Registry Platform was performed using the search terms for the intervention (telephone consultation) and the comparator (general practice). Systematic reviews and randomized control trials that examined telephone consultation compared to normal face-to-face consultation in general practice were included in this review. Papers were reviewed, assessed for quality (Cochrane Collaboration’s ‘Risk of bias’ tool) and data extracted and analysed. RESULTS: Two systematic reviews and one RCT were identified and included in the analysis. The RCT (N = 388) was of patients requesting same-day appointments from two general practices and patients were randomized to a same-day face-to-face appointment or a telephone call back consultation. There was a reduction in the time spent on consultations in the telephone group (1.5 min (0.6 to 2.4)) and patients in the telephone arm had 0.2 (0 to 0.3) more follow-up consultations than the face-to-face group. One systematic review focused on telephone consultation and triage on healthcare use, and included one RCT and one other observational study that examined telephone consultations. The other systematic review focused on patient access and included one RCT and four observational studies that examined telephone consultations. Both systematic reviews provided narrative interpretations of the evidence and concluded that telephone consultations provided an appropriate alternative to telephone consultations and reduced practice work load. CONCLUSION: There is a lack of high level evidence for telephone consultations in a GP setting; however, current evidence suggests that telephone consultations as an alternative to face-to-face general practice consultations offers an appropriate option in certain settings. SYSTEMATIC REVIEW REGISTRATION: PROSPERO CRD42015025225 ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s13643-017-0529-0) contains supplementary material, which is available to authorized users.
format Online
Article
Text
id pubmed-5496327
institution National Center for Biotechnology Information
language English
publishDate 2017
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-54963272017-07-05 Telephone consultations for general practice: a systematic review Downes, Martin J Mervin, Merehau C Byrnes, Joshua M Scuffham, Paul A Syst Rev Research BACKGROUND: The use of information technology, including internet- and telephone-based resources, is becoming an alternative and supporting method of providing many forms of services in a healthcare and health management setting. Telephone consultations provide a promising alternative and supporting service for face-to-face general practice care. The aim of this review is to utilize a systematic review to collate evidence on the use of telephone consultation as an alternative to face-to-face general practice visits. METHODS: A systematic search of MEDLINE, CINAHL, The Cochrane Library, and the International Clinical Trials Registry Platform was performed using the search terms for the intervention (telephone consultation) and the comparator (general practice). Systematic reviews and randomized control trials that examined telephone consultation compared to normal face-to-face consultation in general practice were included in this review. Papers were reviewed, assessed for quality (Cochrane Collaboration’s ‘Risk of bias’ tool) and data extracted and analysed. RESULTS: Two systematic reviews and one RCT were identified and included in the analysis. The RCT (N = 388) was of patients requesting same-day appointments from two general practices and patients were randomized to a same-day face-to-face appointment or a telephone call back consultation. There was a reduction in the time spent on consultations in the telephone group (1.5 min (0.6 to 2.4)) and patients in the telephone arm had 0.2 (0 to 0.3) more follow-up consultations than the face-to-face group. One systematic review focused on telephone consultation and triage on healthcare use, and included one RCT and one other observational study that examined telephone consultations. The other systematic review focused on patient access and included one RCT and four observational studies that examined telephone consultations. Both systematic reviews provided narrative interpretations of the evidence and concluded that telephone consultations provided an appropriate alternative to telephone consultations and reduced practice work load. CONCLUSION: There is a lack of high level evidence for telephone consultations in a GP setting; however, current evidence suggests that telephone consultations as an alternative to face-to-face general practice consultations offers an appropriate option in certain settings. SYSTEMATIC REVIEW REGISTRATION: PROSPERO CRD42015025225 ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s13643-017-0529-0) contains supplementary material, which is available to authorized users. BioMed Central 2017-07-03 /pmc/articles/PMC5496327/ /pubmed/28673333 http://dx.doi.org/10.1186/s13643-017-0529-0 Text en © The Author(s). 2017 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research
Downes, Martin J
Mervin, Merehau C
Byrnes, Joshua M
Scuffham, Paul A
Telephone consultations for general practice: a systematic review
title Telephone consultations for general practice: a systematic review
title_full Telephone consultations for general practice: a systematic review
title_fullStr Telephone consultations for general practice: a systematic review
title_full_unstemmed Telephone consultations for general practice: a systematic review
title_short Telephone consultations for general practice: a systematic review
title_sort telephone consultations for general practice: a systematic review
topic Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5496327/
https://www.ncbi.nlm.nih.gov/pubmed/28673333
http://dx.doi.org/10.1186/s13643-017-0529-0
work_keys_str_mv AT downesmartinj telephoneconsultationsforgeneralpracticeasystematicreview
AT mervinmerehauc telephoneconsultationsforgeneralpracticeasystematicreview
AT byrnesjoshuam telephoneconsultationsforgeneralpracticeasystematicreview
AT scuffhampaula telephoneconsultationsforgeneralpracticeasystematicreview