Cargando…

Myeloma prognostic index at diagnosis might be a prognostic marker in patients newly diagnosed with multiple myeloma

BACKGROUND/AIMS: The aims of this study were to identify the value of inflammatory markers as pretreatment prognostic factors for patients with multiple myeloma (MM) and to estimate the value of a prognostic index including these markers at diagnosis. METHODS: A total of 273 newly diagnosed MM patie...

Descripción completa

Detalles Bibliográficos
Autores principales: Kim, Dae Sik, Yu, Eun Sang, Kang, Ka-Won, Lee, Se Ryeon, Park, Yong, Sung, Hwa Jung, Choi, Chul Won, Kim, Byung Soo
Formato: Online Artículo Texto
Lenguaje:English
Publicado: The Korean Association of Internal Medicine 2017
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5511937/
https://www.ncbi.nlm.nih.gov/pubmed/27809455
http://dx.doi.org/10.3904/kjim.2016.054
_version_ 1783250421740994560
author Kim, Dae Sik
Yu, Eun Sang
Kang, Ka-Won
Lee, Se Ryeon
Park, Yong
Sung, Hwa Jung
Choi, Chul Won
Kim, Byung Soo
author_facet Kim, Dae Sik
Yu, Eun Sang
Kang, Ka-Won
Lee, Se Ryeon
Park, Yong
Sung, Hwa Jung
Choi, Chul Won
Kim, Byung Soo
author_sort Kim, Dae Sik
collection PubMed
description BACKGROUND/AIMS: The aims of this study were to identify the value of inflammatory markers as pretreatment prognostic factors for patients with multiple myeloma (MM) and to estimate the value of a prognostic index including these markers at diagnosis. METHODS: A total of 273 newly diagnosed MM patients undergoing active treatment were analyzed in this study. The prognostic values for survival of the pretreatment inflammatory markers were investigated. A myeloma prognostic index (MPI) was derived using prognostic factors determined to be independently significant on multivariate analysis. RESULTS: A high pretreatment neutrophil-lymphocyte ratio (NLR), low platelet count, and high C-reactive protein (CRP) level had independently unfavorable significance for overall survival (OS). The MPI was derived based on these factors. Per the MPI, 1 point each was assigned to high NLR, low platelet count, and high CRP. Risk categories were stratified into low- (score 0), intermediate- (score 1), and high-risk (score 2 or 3) groups. The MPI demonstrated independent statistical significance for OS on multivariate analysis ([intermediate: hazard ratio (HR), 1.91; 95% confidence interval (CI), 1.12 to 3.24] and [high: HR, 3.37; 95% CI, 2.00 to 5.69]; p < 0.001). Moreover, this significance could be observed regardless of age, renal function, and exposure to novel agents. In addition, the International Staging System risk group could be further significantly stratified using the MPI. CONCLUSIONS: The MPI, consisting of pretreatment inflammatory markers, NLR, platelet count, and CRP, might be effective in predicting the survival of newly diagnosed MM patients undergoing active treatment.
format Online
Article
Text
id pubmed-5511937
institution National Center for Biotechnology Information
language English
publishDate 2017
publisher The Korean Association of Internal Medicine
record_format MEDLINE/PubMed
spelling pubmed-55119372017-07-17 Myeloma prognostic index at diagnosis might be a prognostic marker in patients newly diagnosed with multiple myeloma Kim, Dae Sik Yu, Eun Sang Kang, Ka-Won Lee, Se Ryeon Park, Yong Sung, Hwa Jung Choi, Chul Won Kim, Byung Soo Korean J Intern Med Original Article BACKGROUND/AIMS: The aims of this study were to identify the value of inflammatory markers as pretreatment prognostic factors for patients with multiple myeloma (MM) and to estimate the value of a prognostic index including these markers at diagnosis. METHODS: A total of 273 newly diagnosed MM patients undergoing active treatment were analyzed in this study. The prognostic values for survival of the pretreatment inflammatory markers were investigated. A myeloma prognostic index (MPI) was derived using prognostic factors determined to be independently significant on multivariate analysis. RESULTS: A high pretreatment neutrophil-lymphocyte ratio (NLR), low platelet count, and high C-reactive protein (CRP) level had independently unfavorable significance for overall survival (OS). The MPI was derived based on these factors. Per the MPI, 1 point each was assigned to high NLR, low platelet count, and high CRP. Risk categories were stratified into low- (score 0), intermediate- (score 1), and high-risk (score 2 or 3) groups. The MPI demonstrated independent statistical significance for OS on multivariate analysis ([intermediate: hazard ratio (HR), 1.91; 95% confidence interval (CI), 1.12 to 3.24] and [high: HR, 3.37; 95% CI, 2.00 to 5.69]; p < 0.001). Moreover, this significance could be observed regardless of age, renal function, and exposure to novel agents. In addition, the International Staging System risk group could be further significantly stratified using the MPI. CONCLUSIONS: The MPI, consisting of pretreatment inflammatory markers, NLR, platelet count, and CRP, might be effective in predicting the survival of newly diagnosed MM patients undergoing active treatment. The Korean Association of Internal Medicine 2017-07 2016-11-04 /pmc/articles/PMC5511937/ /pubmed/27809455 http://dx.doi.org/10.3904/kjim.2016.054 Text en Copyright © 2016 The Korean Association of Internal Medicine This is an Open Access article distributed under the terms of the Creative Commons Attribution Non-Commercial License (http://creativecommons.org/licenses/by-nc/3.0/) which permits unrestricted noncommercial use, distribution, and reproduction in any medium, provided the original work is properly cited.
spellingShingle Original Article
Kim, Dae Sik
Yu, Eun Sang
Kang, Ka-Won
Lee, Se Ryeon
Park, Yong
Sung, Hwa Jung
Choi, Chul Won
Kim, Byung Soo
Myeloma prognostic index at diagnosis might be a prognostic marker in patients newly diagnosed with multiple myeloma
title Myeloma prognostic index at diagnosis might be a prognostic marker in patients newly diagnosed with multiple myeloma
title_full Myeloma prognostic index at diagnosis might be a prognostic marker in patients newly diagnosed with multiple myeloma
title_fullStr Myeloma prognostic index at diagnosis might be a prognostic marker in patients newly diagnosed with multiple myeloma
title_full_unstemmed Myeloma prognostic index at diagnosis might be a prognostic marker in patients newly diagnosed with multiple myeloma
title_short Myeloma prognostic index at diagnosis might be a prognostic marker in patients newly diagnosed with multiple myeloma
title_sort myeloma prognostic index at diagnosis might be a prognostic marker in patients newly diagnosed with multiple myeloma
topic Original Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5511937/
https://www.ncbi.nlm.nih.gov/pubmed/27809455
http://dx.doi.org/10.3904/kjim.2016.054
work_keys_str_mv AT kimdaesik myelomaprognosticindexatdiagnosismightbeaprognosticmarkerinpatientsnewlydiagnosedwithmultiplemyeloma
AT yueunsang myelomaprognosticindexatdiagnosismightbeaprognosticmarkerinpatientsnewlydiagnosedwithmultiplemyeloma
AT kangkawon myelomaprognosticindexatdiagnosismightbeaprognosticmarkerinpatientsnewlydiagnosedwithmultiplemyeloma
AT leeseryeon myelomaprognosticindexatdiagnosismightbeaprognosticmarkerinpatientsnewlydiagnosedwithmultiplemyeloma
AT parkyong myelomaprognosticindexatdiagnosismightbeaprognosticmarkerinpatientsnewlydiagnosedwithmultiplemyeloma
AT sunghwajung myelomaprognosticindexatdiagnosismightbeaprognosticmarkerinpatientsnewlydiagnosedwithmultiplemyeloma
AT choichulwon myelomaprognosticindexatdiagnosismightbeaprognosticmarkerinpatientsnewlydiagnosedwithmultiplemyeloma
AT kimbyungsoo myelomaprognosticindexatdiagnosismightbeaprognosticmarkerinpatientsnewlydiagnosedwithmultiplemyeloma