Cargando…
Myeloma prognostic index at diagnosis might be a prognostic marker in patients newly diagnosed with multiple myeloma
BACKGROUND/AIMS: The aims of this study were to identify the value of inflammatory markers as pretreatment prognostic factors for patients with multiple myeloma (MM) and to estimate the value of a prognostic index including these markers at diagnosis. METHODS: A total of 273 newly diagnosed MM patie...
Autores principales: | , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
The Korean Association of Internal Medicine
2017
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5511937/ https://www.ncbi.nlm.nih.gov/pubmed/27809455 http://dx.doi.org/10.3904/kjim.2016.054 |
_version_ | 1783250421740994560 |
---|---|
author | Kim, Dae Sik Yu, Eun Sang Kang, Ka-Won Lee, Se Ryeon Park, Yong Sung, Hwa Jung Choi, Chul Won Kim, Byung Soo |
author_facet | Kim, Dae Sik Yu, Eun Sang Kang, Ka-Won Lee, Se Ryeon Park, Yong Sung, Hwa Jung Choi, Chul Won Kim, Byung Soo |
author_sort | Kim, Dae Sik |
collection | PubMed |
description | BACKGROUND/AIMS: The aims of this study were to identify the value of inflammatory markers as pretreatment prognostic factors for patients with multiple myeloma (MM) and to estimate the value of a prognostic index including these markers at diagnosis. METHODS: A total of 273 newly diagnosed MM patients undergoing active treatment were analyzed in this study. The prognostic values for survival of the pretreatment inflammatory markers were investigated. A myeloma prognostic index (MPI) was derived using prognostic factors determined to be independently significant on multivariate analysis. RESULTS: A high pretreatment neutrophil-lymphocyte ratio (NLR), low platelet count, and high C-reactive protein (CRP) level had independently unfavorable significance for overall survival (OS). The MPI was derived based on these factors. Per the MPI, 1 point each was assigned to high NLR, low platelet count, and high CRP. Risk categories were stratified into low- (score 0), intermediate- (score 1), and high-risk (score 2 or 3) groups. The MPI demonstrated independent statistical significance for OS on multivariate analysis ([intermediate: hazard ratio (HR), 1.91; 95% confidence interval (CI), 1.12 to 3.24] and [high: HR, 3.37; 95% CI, 2.00 to 5.69]; p < 0.001). Moreover, this significance could be observed regardless of age, renal function, and exposure to novel agents. In addition, the International Staging System risk group could be further significantly stratified using the MPI. CONCLUSIONS: The MPI, consisting of pretreatment inflammatory markers, NLR, platelet count, and CRP, might be effective in predicting the survival of newly diagnosed MM patients undergoing active treatment. |
format | Online Article Text |
id | pubmed-5511937 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2017 |
publisher | The Korean Association of Internal Medicine |
record_format | MEDLINE/PubMed |
spelling | pubmed-55119372017-07-17 Myeloma prognostic index at diagnosis might be a prognostic marker in patients newly diagnosed with multiple myeloma Kim, Dae Sik Yu, Eun Sang Kang, Ka-Won Lee, Se Ryeon Park, Yong Sung, Hwa Jung Choi, Chul Won Kim, Byung Soo Korean J Intern Med Original Article BACKGROUND/AIMS: The aims of this study were to identify the value of inflammatory markers as pretreatment prognostic factors for patients with multiple myeloma (MM) and to estimate the value of a prognostic index including these markers at diagnosis. METHODS: A total of 273 newly diagnosed MM patients undergoing active treatment were analyzed in this study. The prognostic values for survival of the pretreatment inflammatory markers were investigated. A myeloma prognostic index (MPI) was derived using prognostic factors determined to be independently significant on multivariate analysis. RESULTS: A high pretreatment neutrophil-lymphocyte ratio (NLR), low platelet count, and high C-reactive protein (CRP) level had independently unfavorable significance for overall survival (OS). The MPI was derived based on these factors. Per the MPI, 1 point each was assigned to high NLR, low platelet count, and high CRP. Risk categories were stratified into low- (score 0), intermediate- (score 1), and high-risk (score 2 or 3) groups. The MPI demonstrated independent statistical significance for OS on multivariate analysis ([intermediate: hazard ratio (HR), 1.91; 95% confidence interval (CI), 1.12 to 3.24] and [high: HR, 3.37; 95% CI, 2.00 to 5.69]; p < 0.001). Moreover, this significance could be observed regardless of age, renal function, and exposure to novel agents. In addition, the International Staging System risk group could be further significantly stratified using the MPI. CONCLUSIONS: The MPI, consisting of pretreatment inflammatory markers, NLR, platelet count, and CRP, might be effective in predicting the survival of newly diagnosed MM patients undergoing active treatment. The Korean Association of Internal Medicine 2017-07 2016-11-04 /pmc/articles/PMC5511937/ /pubmed/27809455 http://dx.doi.org/10.3904/kjim.2016.054 Text en Copyright © 2016 The Korean Association of Internal Medicine This is an Open Access article distributed under the terms of the Creative Commons Attribution Non-Commercial License (http://creativecommons.org/licenses/by-nc/3.0/) which permits unrestricted noncommercial use, distribution, and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Original Article Kim, Dae Sik Yu, Eun Sang Kang, Ka-Won Lee, Se Ryeon Park, Yong Sung, Hwa Jung Choi, Chul Won Kim, Byung Soo Myeloma prognostic index at diagnosis might be a prognostic marker in patients newly diagnosed with multiple myeloma |
title | Myeloma prognostic index at diagnosis might be a prognostic marker in patients newly diagnosed with multiple myeloma |
title_full | Myeloma prognostic index at diagnosis might be a prognostic marker in patients newly diagnosed with multiple myeloma |
title_fullStr | Myeloma prognostic index at diagnosis might be a prognostic marker in patients newly diagnosed with multiple myeloma |
title_full_unstemmed | Myeloma prognostic index at diagnosis might be a prognostic marker in patients newly diagnosed with multiple myeloma |
title_short | Myeloma prognostic index at diagnosis might be a prognostic marker in patients newly diagnosed with multiple myeloma |
title_sort | myeloma prognostic index at diagnosis might be a prognostic marker in patients newly diagnosed with multiple myeloma |
topic | Original Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5511937/ https://www.ncbi.nlm.nih.gov/pubmed/27809455 http://dx.doi.org/10.3904/kjim.2016.054 |
work_keys_str_mv | AT kimdaesik myelomaprognosticindexatdiagnosismightbeaprognosticmarkerinpatientsnewlydiagnosedwithmultiplemyeloma AT yueunsang myelomaprognosticindexatdiagnosismightbeaprognosticmarkerinpatientsnewlydiagnosedwithmultiplemyeloma AT kangkawon myelomaprognosticindexatdiagnosismightbeaprognosticmarkerinpatientsnewlydiagnosedwithmultiplemyeloma AT leeseryeon myelomaprognosticindexatdiagnosismightbeaprognosticmarkerinpatientsnewlydiagnosedwithmultiplemyeloma AT parkyong myelomaprognosticindexatdiagnosismightbeaprognosticmarkerinpatientsnewlydiagnosedwithmultiplemyeloma AT sunghwajung myelomaprognosticindexatdiagnosismightbeaprognosticmarkerinpatientsnewlydiagnosedwithmultiplemyeloma AT choichulwon myelomaprognosticindexatdiagnosismightbeaprognosticmarkerinpatientsnewlydiagnosedwithmultiplemyeloma AT kimbyungsoo myelomaprognosticindexatdiagnosismightbeaprognosticmarkerinpatientsnewlydiagnosedwithmultiplemyeloma |