Cargando…

The role of vitamin D in pre-eclampsia: a systematic review

BACKGROUND: The etiology of pre-eclampsia (PE) is not yet fully understood, though current literature indicates an upregulation of inflammatory mediators produced by the placenta as a potential causal mechanism. Vitamin D is known to have anti-inflammatory properties and there is evidence of an inve...

Descripción completa

Detalles Bibliográficos
Autores principales: Purswani, Juhi M., Gala, Pooja, Dwarkanath, Pratibha, Larkin, Heather M., Kurpad, Anura, Mehta, Saurabh
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2017
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5513133/
https://www.ncbi.nlm.nih.gov/pubmed/28709403
http://dx.doi.org/10.1186/s12884-017-1408-3
_version_ 1783250603984551936
author Purswani, Juhi M.
Gala, Pooja
Dwarkanath, Pratibha
Larkin, Heather M.
Kurpad, Anura
Mehta, Saurabh
author_facet Purswani, Juhi M.
Gala, Pooja
Dwarkanath, Pratibha
Larkin, Heather M.
Kurpad, Anura
Mehta, Saurabh
author_sort Purswani, Juhi M.
collection PubMed
description BACKGROUND: The etiology of pre-eclampsia (PE) is not yet fully understood, though current literature indicates an upregulation of inflammatory mediators produced by the placenta as a potential causal mechanism. Vitamin D is known to have anti-inflammatory properties and there is evidence of an inverse relationship between dietary calcium intake and the incidence of PE. Evidence of the role of vitamin D status and supplementation in the etiology and prevention of PE is reviewed in this article along with identification of research gaps to inform future studies. METHODS: We conducted a structured literature search using MEDLINE electronic databases to identify published studies until February 2015. These sources were retrieved, collected, indexed, and assessed for availability of pregnancy-related data on PE and vitamin D. RESULTS: Several case-control studies and cross-sectional studies have shown an association between vitamin D status and PE, although evidence has been inconsistent. Clinical trials to date have been unable to show an independent effect of vitamin D supplementation in preventing PE. CONCLUSIONS: The included clinical trials do not show an independent effect of vitamin D supplementation in preventing PE; however, issues with dose, timing, and duration of supplementation have not been completely addressed. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s12884-017-1408-3) contains supplementary material, which is available to authorized users.
format Online
Article
Text
id pubmed-5513133
institution National Center for Biotechnology Information
language English
publishDate 2017
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-55131332017-07-19 The role of vitamin D in pre-eclampsia: a systematic review Purswani, Juhi M. Gala, Pooja Dwarkanath, Pratibha Larkin, Heather M. Kurpad, Anura Mehta, Saurabh BMC Pregnancy Childbirth Research Article BACKGROUND: The etiology of pre-eclampsia (PE) is not yet fully understood, though current literature indicates an upregulation of inflammatory mediators produced by the placenta as a potential causal mechanism. Vitamin D is known to have anti-inflammatory properties and there is evidence of an inverse relationship between dietary calcium intake and the incidence of PE. Evidence of the role of vitamin D status and supplementation in the etiology and prevention of PE is reviewed in this article along with identification of research gaps to inform future studies. METHODS: We conducted a structured literature search using MEDLINE electronic databases to identify published studies until February 2015. These sources were retrieved, collected, indexed, and assessed for availability of pregnancy-related data on PE and vitamin D. RESULTS: Several case-control studies and cross-sectional studies have shown an association between vitamin D status and PE, although evidence has been inconsistent. Clinical trials to date have been unable to show an independent effect of vitamin D supplementation in preventing PE. CONCLUSIONS: The included clinical trials do not show an independent effect of vitamin D supplementation in preventing PE; however, issues with dose, timing, and duration of supplementation have not been completely addressed. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s12884-017-1408-3) contains supplementary material, which is available to authorized users. BioMed Central 2017-07-15 /pmc/articles/PMC5513133/ /pubmed/28709403 http://dx.doi.org/10.1186/s12884-017-1408-3 Text en © The Author(s). 2017 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research Article
Purswani, Juhi M.
Gala, Pooja
Dwarkanath, Pratibha
Larkin, Heather M.
Kurpad, Anura
Mehta, Saurabh
The role of vitamin D in pre-eclampsia: a systematic review
title The role of vitamin D in pre-eclampsia: a systematic review
title_full The role of vitamin D in pre-eclampsia: a systematic review
title_fullStr The role of vitamin D in pre-eclampsia: a systematic review
title_full_unstemmed The role of vitamin D in pre-eclampsia: a systematic review
title_short The role of vitamin D in pre-eclampsia: a systematic review
title_sort role of vitamin d in pre-eclampsia: a systematic review
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5513133/
https://www.ncbi.nlm.nih.gov/pubmed/28709403
http://dx.doi.org/10.1186/s12884-017-1408-3
work_keys_str_mv AT purswanijuhim theroleofvitamindinpreeclampsiaasystematicreview
AT galapooja theroleofvitamindinpreeclampsiaasystematicreview
AT dwarkanathpratibha theroleofvitamindinpreeclampsiaasystematicreview
AT larkinheatherm theroleofvitamindinpreeclampsiaasystematicreview
AT kurpadanura theroleofvitamindinpreeclampsiaasystematicreview
AT mehtasaurabh theroleofvitamindinpreeclampsiaasystematicreview
AT purswanijuhim roleofvitamindinpreeclampsiaasystematicreview
AT galapooja roleofvitamindinpreeclampsiaasystematicreview
AT dwarkanathpratibha roleofvitamindinpreeclampsiaasystematicreview
AT larkinheatherm roleofvitamindinpreeclampsiaasystematicreview
AT kurpadanura roleofvitamindinpreeclampsiaasystematicreview
AT mehtasaurabh roleofvitamindinpreeclampsiaasystematicreview