Cargando…
The role of vitamin D in pre-eclampsia: a systematic review
BACKGROUND: The etiology of pre-eclampsia (PE) is not yet fully understood, though current literature indicates an upregulation of inflammatory mediators produced by the placenta as a potential causal mechanism. Vitamin D is known to have anti-inflammatory properties and there is evidence of an inve...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2017
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5513133/ https://www.ncbi.nlm.nih.gov/pubmed/28709403 http://dx.doi.org/10.1186/s12884-017-1408-3 |
_version_ | 1783250603984551936 |
---|---|
author | Purswani, Juhi M. Gala, Pooja Dwarkanath, Pratibha Larkin, Heather M. Kurpad, Anura Mehta, Saurabh |
author_facet | Purswani, Juhi M. Gala, Pooja Dwarkanath, Pratibha Larkin, Heather M. Kurpad, Anura Mehta, Saurabh |
author_sort | Purswani, Juhi M. |
collection | PubMed |
description | BACKGROUND: The etiology of pre-eclampsia (PE) is not yet fully understood, though current literature indicates an upregulation of inflammatory mediators produced by the placenta as a potential causal mechanism. Vitamin D is known to have anti-inflammatory properties and there is evidence of an inverse relationship between dietary calcium intake and the incidence of PE. Evidence of the role of vitamin D status and supplementation in the etiology and prevention of PE is reviewed in this article along with identification of research gaps to inform future studies. METHODS: We conducted a structured literature search using MEDLINE electronic databases to identify published studies until February 2015. These sources were retrieved, collected, indexed, and assessed for availability of pregnancy-related data on PE and vitamin D. RESULTS: Several case-control studies and cross-sectional studies have shown an association between vitamin D status and PE, although evidence has been inconsistent. Clinical trials to date have been unable to show an independent effect of vitamin D supplementation in preventing PE. CONCLUSIONS: The included clinical trials do not show an independent effect of vitamin D supplementation in preventing PE; however, issues with dose, timing, and duration of supplementation have not been completely addressed. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s12884-017-1408-3) contains supplementary material, which is available to authorized users. |
format | Online Article Text |
id | pubmed-5513133 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2017 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-55131332017-07-19 The role of vitamin D in pre-eclampsia: a systematic review Purswani, Juhi M. Gala, Pooja Dwarkanath, Pratibha Larkin, Heather M. Kurpad, Anura Mehta, Saurabh BMC Pregnancy Childbirth Research Article BACKGROUND: The etiology of pre-eclampsia (PE) is not yet fully understood, though current literature indicates an upregulation of inflammatory mediators produced by the placenta as a potential causal mechanism. Vitamin D is known to have anti-inflammatory properties and there is evidence of an inverse relationship between dietary calcium intake and the incidence of PE. Evidence of the role of vitamin D status and supplementation in the etiology and prevention of PE is reviewed in this article along with identification of research gaps to inform future studies. METHODS: We conducted a structured literature search using MEDLINE electronic databases to identify published studies until February 2015. These sources were retrieved, collected, indexed, and assessed for availability of pregnancy-related data on PE and vitamin D. RESULTS: Several case-control studies and cross-sectional studies have shown an association between vitamin D status and PE, although evidence has been inconsistent. Clinical trials to date have been unable to show an independent effect of vitamin D supplementation in preventing PE. CONCLUSIONS: The included clinical trials do not show an independent effect of vitamin D supplementation in preventing PE; however, issues with dose, timing, and duration of supplementation have not been completely addressed. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s12884-017-1408-3) contains supplementary material, which is available to authorized users. BioMed Central 2017-07-15 /pmc/articles/PMC5513133/ /pubmed/28709403 http://dx.doi.org/10.1186/s12884-017-1408-3 Text en © The Author(s). 2017 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Article Purswani, Juhi M. Gala, Pooja Dwarkanath, Pratibha Larkin, Heather M. Kurpad, Anura Mehta, Saurabh The role of vitamin D in pre-eclampsia: a systematic review |
title | The role of vitamin D in pre-eclampsia: a systematic review |
title_full | The role of vitamin D in pre-eclampsia: a systematic review |
title_fullStr | The role of vitamin D in pre-eclampsia: a systematic review |
title_full_unstemmed | The role of vitamin D in pre-eclampsia: a systematic review |
title_short | The role of vitamin D in pre-eclampsia: a systematic review |
title_sort | role of vitamin d in pre-eclampsia: a systematic review |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5513133/ https://www.ncbi.nlm.nih.gov/pubmed/28709403 http://dx.doi.org/10.1186/s12884-017-1408-3 |
work_keys_str_mv | AT purswanijuhim theroleofvitamindinpreeclampsiaasystematicreview AT galapooja theroleofvitamindinpreeclampsiaasystematicreview AT dwarkanathpratibha theroleofvitamindinpreeclampsiaasystematicreview AT larkinheatherm theroleofvitamindinpreeclampsiaasystematicreview AT kurpadanura theroleofvitamindinpreeclampsiaasystematicreview AT mehtasaurabh theroleofvitamindinpreeclampsiaasystematicreview AT purswanijuhim roleofvitamindinpreeclampsiaasystematicreview AT galapooja roleofvitamindinpreeclampsiaasystematicreview AT dwarkanathpratibha roleofvitamindinpreeclampsiaasystematicreview AT larkinheatherm roleofvitamindinpreeclampsiaasystematicreview AT kurpadanura roleofvitamindinpreeclampsiaasystematicreview AT mehtasaurabh roleofvitamindinpreeclampsiaasystematicreview |