Cargando…

Implementation of a Large System-Wide Hepatitis C Virus Screening and Linkage to Care Program for Baby Boomers

BACKGROUND: We implemented and evaluated a large health system-wide hepatitis C virus (HCV) screening and linkage to care program for persons born between 1945 and 1965 (“baby boomers”). METHODS: An electronic health record (EHR) clinical decision support (CDS) tool for HCV screening for baby boomer...

Descripción completa

Detalles Bibliográficos
Autores principales: Castrejón, Mariana, Chew, Kara W., Javanbakht, Marjan, Humphries, Romney, Saab, Sammy, Klausner, Jeffrey D.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Oxford University Press 2017
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5527269/
https://www.ncbi.nlm.nih.gov/pubmed/28752101
http://dx.doi.org/10.1093/ofid/ofx109
_version_ 1783252942664499200
author Castrejón, Mariana
Chew, Kara W.
Javanbakht, Marjan
Humphries, Romney
Saab, Sammy
Klausner, Jeffrey D.
author_facet Castrejón, Mariana
Chew, Kara W.
Javanbakht, Marjan
Humphries, Romney
Saab, Sammy
Klausner, Jeffrey D.
author_sort Castrejón, Mariana
collection PubMed
description BACKGROUND: We implemented and evaluated a large health system-wide hepatitis C virus (HCV) screening and linkage to care program for persons born between 1945 and 1965 (“baby boomers”). METHODS: An electronic health record (EHR) clinical decision support (CDS) tool for HCV screening for baby boomers was introduced in August 2015 for patients seen in the outpatient University of California, Los Angeles healthcare system setting. An HCV care coordinator was introduced in January 2016 to facilitate linkage to HCV care. We compared HCV testing in the year prior (August 2014–July 2015) to the year after (August 2015–July 2016) implementation of the CDS tool. Among patients with reactive HCV antibody testing, we compared outcomes related to the care cascade including HCV ribonucleic acid (RNA) testing, HCV RNA positivity, and linkage to HCV specialty care. RESULTS: During the study period, 19606 participants were screened for HCV antibody. Hepatitis C virus antibody screening increased 145% (from 5676 patients tested to 13930 tested) after introduction of the CDS intervention. Screening increased across all demographic groups including age, sex, and race/ethnicity, with the greatest increases among those in the older age groups. The addition of an HCV care coordinator increased follow-up HCV RNA testing for HCV antibody positive patients from 83% to 95%. Ninety-four percent of HCV RNA positive patients were linked to care postimplementation. CONCLUSIONS: Introduction of an EHR CDS tool and care coordination markedly increased the number of baby boomers screened for HCV, rates of follow-up HCV RNA testing, and linkage to specialty HCV care for patients with chronic HCV infection.
format Online
Article
Text
id pubmed-5527269
institution National Center for Biotechnology Information
language English
publishDate 2017
publisher Oxford University Press
record_format MEDLINE/PubMed
spelling pubmed-55272692017-07-27 Implementation of a Large System-Wide Hepatitis C Virus Screening and Linkage to Care Program for Baby Boomers Castrejón, Mariana Chew, Kara W. Javanbakht, Marjan Humphries, Romney Saab, Sammy Klausner, Jeffrey D. Open Forum Infect Dis Major Article BACKGROUND: We implemented and evaluated a large health system-wide hepatitis C virus (HCV) screening and linkage to care program for persons born between 1945 and 1965 (“baby boomers”). METHODS: An electronic health record (EHR) clinical decision support (CDS) tool for HCV screening for baby boomers was introduced in August 2015 for patients seen in the outpatient University of California, Los Angeles healthcare system setting. An HCV care coordinator was introduced in January 2016 to facilitate linkage to HCV care. We compared HCV testing in the year prior (August 2014–July 2015) to the year after (August 2015–July 2016) implementation of the CDS tool. Among patients with reactive HCV antibody testing, we compared outcomes related to the care cascade including HCV ribonucleic acid (RNA) testing, HCV RNA positivity, and linkage to HCV specialty care. RESULTS: During the study period, 19606 participants were screened for HCV antibody. Hepatitis C virus antibody screening increased 145% (from 5676 patients tested to 13930 tested) after introduction of the CDS intervention. Screening increased across all demographic groups including age, sex, and race/ethnicity, with the greatest increases among those in the older age groups. The addition of an HCV care coordinator increased follow-up HCV RNA testing for HCV antibody positive patients from 83% to 95%. Ninety-four percent of HCV RNA positive patients were linked to care postimplementation. CONCLUSIONS: Introduction of an EHR CDS tool and care coordination markedly increased the number of baby boomers screened for HCV, rates of follow-up HCV RNA testing, and linkage to specialty HCV care for patients with chronic HCV infection. Oxford University Press 2017-05-27 /pmc/articles/PMC5527269/ /pubmed/28752101 http://dx.doi.org/10.1093/ofid/ofx109 Text en © The Author 2017. Published by Oxford University Press on behalf of Infectious Diseases Society of America. http://creativecommons.org/licenses/by-nc-nd/4.0 This is an Open Access article distributed under the terms of the Creative Commons Attribution-NonCommercial-NoDerivs licence (http://creativecommons.org/licenses/by-nc-nd/4.0/), which permits non-commercial reproduction and distribution of the work, in any medium, provided the original work is not altered or transformed in any way, and that the work is properly cited. For commercial re-use, please contact journals.permissions@oup.com.
spellingShingle Major Article
Castrejón, Mariana
Chew, Kara W.
Javanbakht, Marjan
Humphries, Romney
Saab, Sammy
Klausner, Jeffrey D.
Implementation of a Large System-Wide Hepatitis C Virus Screening and Linkage to Care Program for Baby Boomers
title Implementation of a Large System-Wide Hepatitis C Virus Screening and Linkage to Care Program for Baby Boomers
title_full Implementation of a Large System-Wide Hepatitis C Virus Screening and Linkage to Care Program for Baby Boomers
title_fullStr Implementation of a Large System-Wide Hepatitis C Virus Screening and Linkage to Care Program for Baby Boomers
title_full_unstemmed Implementation of a Large System-Wide Hepatitis C Virus Screening and Linkage to Care Program for Baby Boomers
title_short Implementation of a Large System-Wide Hepatitis C Virus Screening and Linkage to Care Program for Baby Boomers
title_sort implementation of a large system-wide hepatitis c virus screening and linkage to care program for baby boomers
topic Major Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5527269/
https://www.ncbi.nlm.nih.gov/pubmed/28752101
http://dx.doi.org/10.1093/ofid/ofx109
work_keys_str_mv AT castrejonmariana implementationofalargesystemwidehepatitiscvirusscreeningandlinkagetocareprogramforbabyboomers
AT chewkaraw implementationofalargesystemwidehepatitiscvirusscreeningandlinkagetocareprogramforbabyboomers
AT javanbakhtmarjan implementationofalargesystemwidehepatitiscvirusscreeningandlinkagetocareprogramforbabyboomers
AT humphriesromney implementationofalargesystemwidehepatitiscvirusscreeningandlinkagetocareprogramforbabyboomers
AT saabsammy implementationofalargesystemwidehepatitiscvirusscreeningandlinkagetocareprogramforbabyboomers
AT klausnerjeffreyd implementationofalargesystemwidehepatitiscvirusscreeningandlinkagetocareprogramforbabyboomers