Cargando…

Expression of Merkelcell polyomavirus (MCPyV) large T-antigen in Merkel cell carcinoma lymph node metastases predicts poor outcome

BACKGROUND: The aim of this study was to determine the prevalence of MCPyV in Merkel cell carcinoma (MCC) primaries versus lymph node metastasis and to evaluate possible prognostic factors. METHODS: Samples of MCC primaries and lymph node metastases were stained immunohistochemically for the MCPyV l...

Descripción completa

Detalles Bibliográficos
Autores principales: Haymerle, Georg, Janik, Stefan, Fochtmann, Alexandra, Pammer, Johannes, Schachner, Helga, Nemec, Lucas, Mildner, Michael, Houben, Roland, Grasl, Matthaeus Ch., Erovic, Boban M.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Public Library of Science 2017
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5538748/
https://www.ncbi.nlm.nih.gov/pubmed/28763479
http://dx.doi.org/10.1371/journal.pone.0180426
_version_ 1783254398351179776
author Haymerle, Georg
Janik, Stefan
Fochtmann, Alexandra
Pammer, Johannes
Schachner, Helga
Nemec, Lucas
Mildner, Michael
Houben, Roland
Grasl, Matthaeus Ch.
Erovic, Boban M.
author_facet Haymerle, Georg
Janik, Stefan
Fochtmann, Alexandra
Pammer, Johannes
Schachner, Helga
Nemec, Lucas
Mildner, Michael
Houben, Roland
Grasl, Matthaeus Ch.
Erovic, Boban M.
author_sort Haymerle, Georg
collection PubMed
description BACKGROUND: The aim of this study was to determine the prevalence of MCPyV in Merkel cell carcinoma (MCC) primaries versus lymph node metastasis and to evaluate possible prognostic factors. METHODS: Samples of MCC primaries and lymph node metastases were stained immunohistochemically for the MCPyV large T-antigen and expression was compared to patients´ clinical outcome. RESULTS: 41 MCC patients were included. 33 (61%) out of 54 specimens were MCPyV-positive in the immunohistochemistry. 15 (47%) out of 32 primary tumors were positive compared to 18 (82%) out of 22 lymph node metastases. Eleven patients with positive polyomavirus expression died from the carcinoma compared to 4 patients without virus expression. Cox regression analysis showed worse disease-free survival in patients with MCPyV compared to virus-negative lymph nodes (p = 0.002). CONCLUSIONS: To our knowledge this is the first study to describe a negative prognostic effect of the MCPyV expression in lymph node metastasis in MCC patients.
format Online
Article
Text
id pubmed-5538748
institution National Center for Biotechnology Information
language English
publishDate 2017
publisher Public Library of Science
record_format MEDLINE/PubMed
spelling pubmed-55387482017-08-07 Expression of Merkelcell polyomavirus (MCPyV) large T-antigen in Merkel cell carcinoma lymph node metastases predicts poor outcome Haymerle, Georg Janik, Stefan Fochtmann, Alexandra Pammer, Johannes Schachner, Helga Nemec, Lucas Mildner, Michael Houben, Roland Grasl, Matthaeus Ch. Erovic, Boban M. PLoS One Research Article BACKGROUND: The aim of this study was to determine the prevalence of MCPyV in Merkel cell carcinoma (MCC) primaries versus lymph node metastasis and to evaluate possible prognostic factors. METHODS: Samples of MCC primaries and lymph node metastases were stained immunohistochemically for the MCPyV large T-antigen and expression was compared to patients´ clinical outcome. RESULTS: 41 MCC patients were included. 33 (61%) out of 54 specimens were MCPyV-positive in the immunohistochemistry. 15 (47%) out of 32 primary tumors were positive compared to 18 (82%) out of 22 lymph node metastases. Eleven patients with positive polyomavirus expression died from the carcinoma compared to 4 patients without virus expression. Cox regression analysis showed worse disease-free survival in patients with MCPyV compared to virus-negative lymph nodes (p = 0.002). CONCLUSIONS: To our knowledge this is the first study to describe a negative prognostic effect of the MCPyV expression in lymph node metastasis in MCC patients. Public Library of Science 2017-08-01 /pmc/articles/PMC5538748/ /pubmed/28763479 http://dx.doi.org/10.1371/journal.pone.0180426 Text en © 2017 Haymerle et al http://creativecommons.org/licenses/by/4.0/ This is an open access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/) , which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited.
spellingShingle Research Article
Haymerle, Georg
Janik, Stefan
Fochtmann, Alexandra
Pammer, Johannes
Schachner, Helga
Nemec, Lucas
Mildner, Michael
Houben, Roland
Grasl, Matthaeus Ch.
Erovic, Boban M.
Expression of Merkelcell polyomavirus (MCPyV) large T-antigen in Merkel cell carcinoma lymph node metastases predicts poor outcome
title Expression of Merkelcell polyomavirus (MCPyV) large T-antigen in Merkel cell carcinoma lymph node metastases predicts poor outcome
title_full Expression of Merkelcell polyomavirus (MCPyV) large T-antigen in Merkel cell carcinoma lymph node metastases predicts poor outcome
title_fullStr Expression of Merkelcell polyomavirus (MCPyV) large T-antigen in Merkel cell carcinoma lymph node metastases predicts poor outcome
title_full_unstemmed Expression of Merkelcell polyomavirus (MCPyV) large T-antigen in Merkel cell carcinoma lymph node metastases predicts poor outcome
title_short Expression of Merkelcell polyomavirus (MCPyV) large T-antigen in Merkel cell carcinoma lymph node metastases predicts poor outcome
title_sort expression of merkelcell polyomavirus (mcpyv) large t-antigen in merkel cell carcinoma lymph node metastases predicts poor outcome
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5538748/
https://www.ncbi.nlm.nih.gov/pubmed/28763479
http://dx.doi.org/10.1371/journal.pone.0180426
work_keys_str_mv AT haymerlegeorg expressionofmerkelcellpolyomavirusmcpyvlargetantigeninmerkelcellcarcinomalymphnodemetastasespredictspooroutcome
AT janikstefan expressionofmerkelcellpolyomavirusmcpyvlargetantigeninmerkelcellcarcinomalymphnodemetastasespredictspooroutcome
AT fochtmannalexandra expressionofmerkelcellpolyomavirusmcpyvlargetantigeninmerkelcellcarcinomalymphnodemetastasespredictspooroutcome
AT pammerjohannes expressionofmerkelcellpolyomavirusmcpyvlargetantigeninmerkelcellcarcinomalymphnodemetastasespredictspooroutcome
AT schachnerhelga expressionofmerkelcellpolyomavirusmcpyvlargetantigeninmerkelcellcarcinomalymphnodemetastasespredictspooroutcome
AT nemeclucas expressionofmerkelcellpolyomavirusmcpyvlargetantigeninmerkelcellcarcinomalymphnodemetastasespredictspooroutcome
AT mildnermichael expressionofmerkelcellpolyomavirusmcpyvlargetantigeninmerkelcellcarcinomalymphnodemetastasespredictspooroutcome
AT houbenroland expressionofmerkelcellpolyomavirusmcpyvlargetantigeninmerkelcellcarcinomalymphnodemetastasespredictspooroutcome
AT graslmatthaeusch expressionofmerkelcellpolyomavirusmcpyvlargetantigeninmerkelcellcarcinomalymphnodemetastasespredictspooroutcome
AT erovicbobanm expressionofmerkelcellpolyomavirusmcpyvlargetantigeninmerkelcellcarcinomalymphnodemetastasespredictspooroutcome