Cargando…
Expression of Merkelcell polyomavirus (MCPyV) large T-antigen in Merkel cell carcinoma lymph node metastases predicts poor outcome
BACKGROUND: The aim of this study was to determine the prevalence of MCPyV in Merkel cell carcinoma (MCC) primaries versus lymph node metastasis and to evaluate possible prognostic factors. METHODS: Samples of MCC primaries and lymph node metastases were stained immunohistochemically for the MCPyV l...
Autores principales: | , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Public Library of Science
2017
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5538748/ https://www.ncbi.nlm.nih.gov/pubmed/28763479 http://dx.doi.org/10.1371/journal.pone.0180426 |
_version_ | 1783254398351179776 |
---|---|
author | Haymerle, Georg Janik, Stefan Fochtmann, Alexandra Pammer, Johannes Schachner, Helga Nemec, Lucas Mildner, Michael Houben, Roland Grasl, Matthaeus Ch. Erovic, Boban M. |
author_facet | Haymerle, Georg Janik, Stefan Fochtmann, Alexandra Pammer, Johannes Schachner, Helga Nemec, Lucas Mildner, Michael Houben, Roland Grasl, Matthaeus Ch. Erovic, Boban M. |
author_sort | Haymerle, Georg |
collection | PubMed |
description | BACKGROUND: The aim of this study was to determine the prevalence of MCPyV in Merkel cell carcinoma (MCC) primaries versus lymph node metastasis and to evaluate possible prognostic factors. METHODS: Samples of MCC primaries and lymph node metastases were stained immunohistochemically for the MCPyV large T-antigen and expression was compared to patients´ clinical outcome. RESULTS: 41 MCC patients were included. 33 (61%) out of 54 specimens were MCPyV-positive in the immunohistochemistry. 15 (47%) out of 32 primary tumors were positive compared to 18 (82%) out of 22 lymph node metastases. Eleven patients with positive polyomavirus expression died from the carcinoma compared to 4 patients without virus expression. Cox regression analysis showed worse disease-free survival in patients with MCPyV compared to virus-negative lymph nodes (p = 0.002). CONCLUSIONS: To our knowledge this is the first study to describe a negative prognostic effect of the MCPyV expression in lymph node metastasis in MCC patients. |
format | Online Article Text |
id | pubmed-5538748 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2017 |
publisher | Public Library of Science |
record_format | MEDLINE/PubMed |
spelling | pubmed-55387482017-08-07 Expression of Merkelcell polyomavirus (MCPyV) large T-antigen in Merkel cell carcinoma lymph node metastases predicts poor outcome Haymerle, Georg Janik, Stefan Fochtmann, Alexandra Pammer, Johannes Schachner, Helga Nemec, Lucas Mildner, Michael Houben, Roland Grasl, Matthaeus Ch. Erovic, Boban M. PLoS One Research Article BACKGROUND: The aim of this study was to determine the prevalence of MCPyV in Merkel cell carcinoma (MCC) primaries versus lymph node metastasis and to evaluate possible prognostic factors. METHODS: Samples of MCC primaries and lymph node metastases were stained immunohistochemically for the MCPyV large T-antigen and expression was compared to patients´ clinical outcome. RESULTS: 41 MCC patients were included. 33 (61%) out of 54 specimens were MCPyV-positive in the immunohistochemistry. 15 (47%) out of 32 primary tumors were positive compared to 18 (82%) out of 22 lymph node metastases. Eleven patients with positive polyomavirus expression died from the carcinoma compared to 4 patients without virus expression. Cox regression analysis showed worse disease-free survival in patients with MCPyV compared to virus-negative lymph nodes (p = 0.002). CONCLUSIONS: To our knowledge this is the first study to describe a negative prognostic effect of the MCPyV expression in lymph node metastasis in MCC patients. Public Library of Science 2017-08-01 /pmc/articles/PMC5538748/ /pubmed/28763479 http://dx.doi.org/10.1371/journal.pone.0180426 Text en © 2017 Haymerle et al http://creativecommons.org/licenses/by/4.0/ This is an open access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/) , which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited. |
spellingShingle | Research Article Haymerle, Georg Janik, Stefan Fochtmann, Alexandra Pammer, Johannes Schachner, Helga Nemec, Lucas Mildner, Michael Houben, Roland Grasl, Matthaeus Ch. Erovic, Boban M. Expression of Merkelcell polyomavirus (MCPyV) large T-antigen in Merkel cell carcinoma lymph node metastases predicts poor outcome |
title | Expression of Merkelcell polyomavirus (MCPyV) large T-antigen in Merkel cell carcinoma lymph node metastases predicts poor outcome |
title_full | Expression of Merkelcell polyomavirus (MCPyV) large T-antigen in Merkel cell carcinoma lymph node metastases predicts poor outcome |
title_fullStr | Expression of Merkelcell polyomavirus (MCPyV) large T-antigen in Merkel cell carcinoma lymph node metastases predicts poor outcome |
title_full_unstemmed | Expression of Merkelcell polyomavirus (MCPyV) large T-antigen in Merkel cell carcinoma lymph node metastases predicts poor outcome |
title_short | Expression of Merkelcell polyomavirus (MCPyV) large T-antigen in Merkel cell carcinoma lymph node metastases predicts poor outcome |
title_sort | expression of merkelcell polyomavirus (mcpyv) large t-antigen in merkel cell carcinoma lymph node metastases predicts poor outcome |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5538748/ https://www.ncbi.nlm.nih.gov/pubmed/28763479 http://dx.doi.org/10.1371/journal.pone.0180426 |
work_keys_str_mv | AT haymerlegeorg expressionofmerkelcellpolyomavirusmcpyvlargetantigeninmerkelcellcarcinomalymphnodemetastasespredictspooroutcome AT janikstefan expressionofmerkelcellpolyomavirusmcpyvlargetantigeninmerkelcellcarcinomalymphnodemetastasespredictspooroutcome AT fochtmannalexandra expressionofmerkelcellpolyomavirusmcpyvlargetantigeninmerkelcellcarcinomalymphnodemetastasespredictspooroutcome AT pammerjohannes expressionofmerkelcellpolyomavirusmcpyvlargetantigeninmerkelcellcarcinomalymphnodemetastasespredictspooroutcome AT schachnerhelga expressionofmerkelcellpolyomavirusmcpyvlargetantigeninmerkelcellcarcinomalymphnodemetastasespredictspooroutcome AT nemeclucas expressionofmerkelcellpolyomavirusmcpyvlargetantigeninmerkelcellcarcinomalymphnodemetastasespredictspooroutcome AT mildnermichael expressionofmerkelcellpolyomavirusmcpyvlargetantigeninmerkelcellcarcinomalymphnodemetastasespredictspooroutcome AT houbenroland expressionofmerkelcellpolyomavirusmcpyvlargetantigeninmerkelcellcarcinomalymphnodemetastasespredictspooroutcome AT graslmatthaeusch expressionofmerkelcellpolyomavirusmcpyvlargetantigeninmerkelcellcarcinomalymphnodemetastasespredictspooroutcome AT erovicbobanm expressionofmerkelcellpolyomavirusmcpyvlargetantigeninmerkelcellcarcinomalymphnodemetastasespredictspooroutcome |