Cargando…

How do stakeholders from multiple hierarchical levels of a large provincial health system define engagement? A qualitative study

BACKGROUND: Engaging stakeholders from varied organizational levels is essential to successful healthcare quality improvement. However, engagement has been hard to achieve and to measure across diverse stakeholders. Further, current implementation science models provide little clarity about what eng...

Descripción completa

Detalles Bibliográficos
Autores principales: Norris, Jill M., White, Deborah E., Nowell, Lorelli, Mrklas, Kelly, Stelfox, Henry T.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2017
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5540524/
https://www.ncbi.nlm.nih.gov/pubmed/28764728
http://dx.doi.org/10.1186/s13012-017-0625-5
_version_ 1783254650788511744
author Norris, Jill M.
White, Deborah E.
Nowell, Lorelli
Mrklas, Kelly
Stelfox, Henry T.
author_facet Norris, Jill M.
White, Deborah E.
Nowell, Lorelli
Mrklas, Kelly
Stelfox, Henry T.
author_sort Norris, Jill M.
collection PubMed
description BACKGROUND: Engaging stakeholders from varied organizational levels is essential to successful healthcare quality improvement. However, engagement has been hard to achieve and to measure across diverse stakeholders. Further, current implementation science models provide little clarity about what engagement means, despite its importance. The aim of this study was to understand how stakeholders of healthcare improvement initiatives defined engagement. METHODS: Participants (n = 86) in this qualitative thematic study were purposively sampled for individual interviews. Participants included leaders, core members, frontline clinicians, support personnel, and other stakeholders of Strategic Clinical Networks in Alberta Health Services, a Canadian provincial health system with over 108,000 employees. We used an iterative thematic approach to analyze participants’ responses to the question, “How do you define engagement?” RESULTS: Regardless of their organizational role, participants defined engagement through three interrelated themes. First, engagement was active participation from willing and committed stakeholders, with levels that ranged from information sharing to full decision-making. Second, engagement centered on a shared decision-making process about meaningful change for everyone “around the table,” those who are most impacted. Third, engagement was two-way interactions that began early in the change process, where exchanges were respectful and all stakeholders felt heard and understood. CONCLUSIONS: This study highlights the commonalities of how stakeholders in a large healthcare system defined engagement—a shared understanding and terminology—to guide and improve stakeholder engagement. Overall, engagement was an active and committed decision-making about a meaningful problem through respectful interactions and dialog where everyone’s voice is considered. Our results may be used in conjunction with current implementation models to provide clarity about what engagement means and how to engage various stakeholders.
format Online
Article
Text
id pubmed-5540524
institution National Center for Biotechnology Information
language English
publishDate 2017
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-55405242017-08-07 How do stakeholders from multiple hierarchical levels of a large provincial health system define engagement? A qualitative study Norris, Jill M. White, Deborah E. Nowell, Lorelli Mrklas, Kelly Stelfox, Henry T. Implement Sci Research BACKGROUND: Engaging stakeholders from varied organizational levels is essential to successful healthcare quality improvement. However, engagement has been hard to achieve and to measure across diverse stakeholders. Further, current implementation science models provide little clarity about what engagement means, despite its importance. The aim of this study was to understand how stakeholders of healthcare improvement initiatives defined engagement. METHODS: Participants (n = 86) in this qualitative thematic study were purposively sampled for individual interviews. Participants included leaders, core members, frontline clinicians, support personnel, and other stakeholders of Strategic Clinical Networks in Alberta Health Services, a Canadian provincial health system with over 108,000 employees. We used an iterative thematic approach to analyze participants’ responses to the question, “How do you define engagement?” RESULTS: Regardless of their organizational role, participants defined engagement through three interrelated themes. First, engagement was active participation from willing and committed stakeholders, with levels that ranged from information sharing to full decision-making. Second, engagement centered on a shared decision-making process about meaningful change for everyone “around the table,” those who are most impacted. Third, engagement was two-way interactions that began early in the change process, where exchanges were respectful and all stakeholders felt heard and understood. CONCLUSIONS: This study highlights the commonalities of how stakeholders in a large healthcare system defined engagement—a shared understanding and terminology—to guide and improve stakeholder engagement. Overall, engagement was an active and committed decision-making about a meaningful problem through respectful interactions and dialog where everyone’s voice is considered. Our results may be used in conjunction with current implementation models to provide clarity about what engagement means and how to engage various stakeholders. BioMed Central 2017-08-01 /pmc/articles/PMC5540524/ /pubmed/28764728 http://dx.doi.org/10.1186/s13012-017-0625-5 Text en © The Author(s). 2017 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research
Norris, Jill M.
White, Deborah E.
Nowell, Lorelli
Mrklas, Kelly
Stelfox, Henry T.
How do stakeholders from multiple hierarchical levels of a large provincial health system define engagement? A qualitative study
title How do stakeholders from multiple hierarchical levels of a large provincial health system define engagement? A qualitative study
title_full How do stakeholders from multiple hierarchical levels of a large provincial health system define engagement? A qualitative study
title_fullStr How do stakeholders from multiple hierarchical levels of a large provincial health system define engagement? A qualitative study
title_full_unstemmed How do stakeholders from multiple hierarchical levels of a large provincial health system define engagement? A qualitative study
title_short How do stakeholders from multiple hierarchical levels of a large provincial health system define engagement? A qualitative study
title_sort how do stakeholders from multiple hierarchical levels of a large provincial health system define engagement? a qualitative study
topic Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5540524/
https://www.ncbi.nlm.nih.gov/pubmed/28764728
http://dx.doi.org/10.1186/s13012-017-0625-5
work_keys_str_mv AT norrisjillm howdostakeholdersfrommultiplehierarchicallevelsofalargeprovincialhealthsystemdefineengagementaqualitativestudy
AT whitedeborahe howdostakeholdersfrommultiplehierarchicallevelsofalargeprovincialhealthsystemdefineengagementaqualitativestudy
AT nowelllorelli howdostakeholdersfrommultiplehierarchicallevelsofalargeprovincialhealthsystemdefineengagementaqualitativestudy
AT mrklaskelly howdostakeholdersfrommultiplehierarchicallevelsofalargeprovincialhealthsystemdefineengagementaqualitativestudy
AT stelfoxhenryt howdostakeholdersfrommultiplehierarchicallevelsofalargeprovincialhealthsystemdefineengagementaqualitativestudy