Cargando…
Genetic assessment of residual feed intake as a feed efficiency trait in the Pacific white shrimp Litopenaeus vannamei
BACKGROUND: Residual feed intake (RFI) was investigated as a measure of feed efficiency in a breeding population of Litopenaeus vannamei. Shrimp from 34 families were housed individually and feed efficiency and growth traits were recorded during two successive growth periods. The objectives of this...
Autores principales: | , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2017
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5545049/ https://www.ncbi.nlm.nih.gov/pubmed/28778143 http://dx.doi.org/10.1186/s12711-017-0334-1 |
_version_ | 1783255358168367104 |
---|---|
author | Dai, Ping Luan, Sheng Lu, Xia Luo, Kun Meng, Xianhong Cao, Baoxiang Kong, Jie |
author_facet | Dai, Ping Luan, Sheng Lu, Xia Luo, Kun Meng, Xianhong Cao, Baoxiang Kong, Jie |
author_sort | Dai, Ping |
collection | PubMed |
description | BACKGROUND: Residual feed intake (RFI) was investigated as a measure of feed efficiency in a breeding population of Litopenaeus vannamei. Shrimp from 34 families were housed individually and feed efficiency and growth traits were recorded during two successive growth periods. The objectives of this study were (1) to estimate the heritability of RFI and related traits, including feed efficiency ratio (FER), average daily gain (ADG) and daily feed intake (DFI), (2) to determine the relationships between RFI and other traits, and (3) to evaluate the variation of these traits across two growth periods. RESULTS: Shrimp displayed large inter-individual variation in RFI, FER, ADG and DFI during each growth period. Heritability estimates of all these traits during both periods reached high values (0.577 ± 0.232 to 0.707 ± 0.252). RFI showed weak and no genetic correlations with ADG during the two growth periods between days 1 to 21 (0.135 ± 0.204) and 22 to 42 (–0.018 ± 0.128), respectively, but high positive genetic correlations with DFI (>0.8). Weak and moderate negative genetic correlations were observed between RFI and FER during the two periods (–0.126 ± 0.208 and –0.387 ± 0.183). As evidenced by the high genetic correlations between the two periods for each trait (>0.6), trait performance of the shrimp tended to be consistent across periods. CONCLUSIONS: For the first time, accurate measurement of individual feed efficiency on a large scale was achieved in shrimp. Although the estimated heritability reported here for RFI may be overestimated, it is a heritable trait in L. vannamei that can be improved by genetic improvement. For L. vannamei, the biggest potential advantage in using RFI as a measure of feed efficiency is that it is independent of growth rate, and thus genetic selection on RFI has the potential to improve feed efficiency and reduce feed intake, without compromising growth performance. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s12711-017-0334-1) contains supplementary material, which is available to authorized users. |
format | Online Article Text |
id | pubmed-5545049 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2017 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-55450492017-08-07 Genetic assessment of residual feed intake as a feed efficiency trait in the Pacific white shrimp Litopenaeus vannamei Dai, Ping Luan, Sheng Lu, Xia Luo, Kun Meng, Xianhong Cao, Baoxiang Kong, Jie Genet Sel Evol Research Article BACKGROUND: Residual feed intake (RFI) was investigated as a measure of feed efficiency in a breeding population of Litopenaeus vannamei. Shrimp from 34 families were housed individually and feed efficiency and growth traits were recorded during two successive growth periods. The objectives of this study were (1) to estimate the heritability of RFI and related traits, including feed efficiency ratio (FER), average daily gain (ADG) and daily feed intake (DFI), (2) to determine the relationships between RFI and other traits, and (3) to evaluate the variation of these traits across two growth periods. RESULTS: Shrimp displayed large inter-individual variation in RFI, FER, ADG and DFI during each growth period. Heritability estimates of all these traits during both periods reached high values (0.577 ± 0.232 to 0.707 ± 0.252). RFI showed weak and no genetic correlations with ADG during the two growth periods between days 1 to 21 (0.135 ± 0.204) and 22 to 42 (–0.018 ± 0.128), respectively, but high positive genetic correlations with DFI (>0.8). Weak and moderate negative genetic correlations were observed between RFI and FER during the two periods (–0.126 ± 0.208 and –0.387 ± 0.183). As evidenced by the high genetic correlations between the two periods for each trait (>0.6), trait performance of the shrimp tended to be consistent across periods. CONCLUSIONS: For the first time, accurate measurement of individual feed efficiency on a large scale was achieved in shrimp. Although the estimated heritability reported here for RFI may be overestimated, it is a heritable trait in L. vannamei that can be improved by genetic improvement. For L. vannamei, the biggest potential advantage in using RFI as a measure of feed efficiency is that it is independent of growth rate, and thus genetic selection on RFI has the potential to improve feed efficiency and reduce feed intake, without compromising growth performance. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s12711-017-0334-1) contains supplementary material, which is available to authorized users. BioMed Central 2017-08-04 /pmc/articles/PMC5545049/ /pubmed/28778143 http://dx.doi.org/10.1186/s12711-017-0334-1 Text en © The Author(s) 2017 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Article Dai, Ping Luan, Sheng Lu, Xia Luo, Kun Meng, Xianhong Cao, Baoxiang Kong, Jie Genetic assessment of residual feed intake as a feed efficiency trait in the Pacific white shrimp Litopenaeus vannamei |
title | Genetic assessment of residual feed intake as a feed efficiency trait in the Pacific white shrimp Litopenaeus vannamei |
title_full | Genetic assessment of residual feed intake as a feed efficiency trait in the Pacific white shrimp Litopenaeus vannamei |
title_fullStr | Genetic assessment of residual feed intake as a feed efficiency trait in the Pacific white shrimp Litopenaeus vannamei |
title_full_unstemmed | Genetic assessment of residual feed intake as a feed efficiency trait in the Pacific white shrimp Litopenaeus vannamei |
title_short | Genetic assessment of residual feed intake as a feed efficiency trait in the Pacific white shrimp Litopenaeus vannamei |
title_sort | genetic assessment of residual feed intake as a feed efficiency trait in the pacific white shrimp litopenaeus vannamei |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5545049/ https://www.ncbi.nlm.nih.gov/pubmed/28778143 http://dx.doi.org/10.1186/s12711-017-0334-1 |
work_keys_str_mv | AT daiping geneticassessmentofresidualfeedintakeasafeedefficiencytraitinthepacificwhiteshrimplitopenaeusvannamei AT luansheng geneticassessmentofresidualfeedintakeasafeedefficiencytraitinthepacificwhiteshrimplitopenaeusvannamei AT luxia geneticassessmentofresidualfeedintakeasafeedefficiencytraitinthepacificwhiteshrimplitopenaeusvannamei AT luokun geneticassessmentofresidualfeedintakeasafeedefficiencytraitinthepacificwhiteshrimplitopenaeusvannamei AT mengxianhong geneticassessmentofresidualfeedintakeasafeedefficiencytraitinthepacificwhiteshrimplitopenaeusvannamei AT caobaoxiang geneticassessmentofresidualfeedintakeasafeedefficiencytraitinthepacificwhiteshrimplitopenaeusvannamei AT kongjie geneticassessmentofresidualfeedintakeasafeedefficiencytraitinthepacificwhiteshrimplitopenaeusvannamei |