Cargando…
Regulation and Possible Functions of Kisspeptin in the Medial Amygdala
Kisspeptin, encoded by the Kiss1 gene, is required for reproduction. Humans and mice lacking kisspeptin or its receptor, Kiss1r, have impairments in reproductive physiology and fertility. In addition to being located in the hypothalamus in the anteroventral periventricular and arcuate nuclei, kisspe...
Autores principales: | , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Frontiers Media S.A.
2017
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5545938/ https://www.ncbi.nlm.nih.gov/pubmed/28824550 http://dx.doi.org/10.3389/fendo.2017.00191 |
_version_ | 1783255507934380032 |
---|---|
author | Stephens, Shannon B. Z. Kauffman, Alexander S. |
author_facet | Stephens, Shannon B. Z. Kauffman, Alexander S. |
author_sort | Stephens, Shannon B. Z. |
collection | PubMed |
description | Kisspeptin, encoded by the Kiss1 gene, is required for reproduction. Humans and mice lacking kisspeptin or its receptor, Kiss1r, have impairments in reproductive physiology and fertility. In addition to being located in the hypothalamus in the anteroventral periventricular and arcuate nuclei, kisspeptin neurons are also present in several extra-hypothalamic regions, such as the medial amygdala (MeA). However, while there has been a significant focus on the reproductive roles of hypothalamic kisspeptin neurons, the regulation and function(s) of MeA and other extra-hypothalamic kisspeptin neurons have received far less attention. This review summarizes what is currently known about the regulation, development, neural projections, and potential functions of MeA kisspeptin neurons, as well as kisspeptin signaling directly within the MeA, with emphasis on data gathered from rodent models. Recent data are summarized and compared between rodent species and also between males and females. In addition, critical gaps in knowledge and important future directions are discussed. |
format | Online Article Text |
id | pubmed-5545938 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2017 |
publisher | Frontiers Media S.A. |
record_format | MEDLINE/PubMed |
spelling | pubmed-55459382017-08-18 Regulation and Possible Functions of Kisspeptin in the Medial Amygdala Stephens, Shannon B. Z. Kauffman, Alexander S. Front Endocrinol (Lausanne) Endocrinology Kisspeptin, encoded by the Kiss1 gene, is required for reproduction. Humans and mice lacking kisspeptin or its receptor, Kiss1r, have impairments in reproductive physiology and fertility. In addition to being located in the hypothalamus in the anteroventral periventricular and arcuate nuclei, kisspeptin neurons are also present in several extra-hypothalamic regions, such as the medial amygdala (MeA). However, while there has been a significant focus on the reproductive roles of hypothalamic kisspeptin neurons, the regulation and function(s) of MeA and other extra-hypothalamic kisspeptin neurons have received far less attention. This review summarizes what is currently known about the regulation, development, neural projections, and potential functions of MeA kisspeptin neurons, as well as kisspeptin signaling directly within the MeA, with emphasis on data gathered from rodent models. Recent data are summarized and compared between rodent species and also between males and females. In addition, critical gaps in knowledge and important future directions are discussed. Frontiers Media S.A. 2017-08-07 /pmc/articles/PMC5545938/ /pubmed/28824550 http://dx.doi.org/10.3389/fendo.2017.00191 Text en Copyright © 2017 Stephens and Kauffman. http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) or licensor are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms. |
spellingShingle | Endocrinology Stephens, Shannon B. Z. Kauffman, Alexander S. Regulation and Possible Functions of Kisspeptin in the Medial Amygdala |
title | Regulation and Possible Functions of Kisspeptin in the Medial Amygdala |
title_full | Regulation and Possible Functions of Kisspeptin in the Medial Amygdala |
title_fullStr | Regulation and Possible Functions of Kisspeptin in the Medial Amygdala |
title_full_unstemmed | Regulation and Possible Functions of Kisspeptin in the Medial Amygdala |
title_short | Regulation and Possible Functions of Kisspeptin in the Medial Amygdala |
title_sort | regulation and possible functions of kisspeptin in the medial amygdala |
topic | Endocrinology |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5545938/ https://www.ncbi.nlm.nih.gov/pubmed/28824550 http://dx.doi.org/10.3389/fendo.2017.00191 |
work_keys_str_mv | AT stephensshannonbz regulationandpossiblefunctionsofkisspeptininthemedialamygdala AT kauffmanalexanders regulationandpossiblefunctionsofkisspeptininthemedialamygdala |