Cargando…
Noninvasive assessment of gastrointestinal parasites infection in free-ranging wild herbivores and adjoining livestock of Panna Tiger Reserve, Madhya Pradesh, India
AIM: This study was conducted to know the epidemiology of gastrointestinal parasites of free-ranging wild herbivores and adjoining livestock of Panna Tiger Reserve, Madhya Pradesh, India. MATERIALS AND METHODS: A total of 374 fecal samples from wild herbivores (Chital Axis axis - 123, Sambar Rusa un...
Autores principales: | , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Veterinary World
2017
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5553141/ https://www.ncbi.nlm.nih.gov/pubmed/28831216 http://dx.doi.org/10.14202/vetworld.2017.748-751 |
_version_ | 1783256584514699264 |
---|---|
author | Sengar, Abhay Shrivastav, A. B. Singh, K. P. Rokde, Amol |
author_facet | Sengar, Abhay Shrivastav, A. B. Singh, K. P. Rokde, Amol |
author_sort | Sengar, Abhay |
collection | PubMed |
description | AIM: This study was conducted to know the epidemiology of gastrointestinal parasites of free-ranging wild herbivores and adjoining livestock of Panna Tiger Reserve, Madhya Pradesh, India. MATERIALS AND METHODS: A total of 374 fecal samples from wild herbivores (Chital Axis axis - 123, Sambar Rusa unicolor - 94, Nilgai Boselaphus tragocamelus - 86, and Chinkara Gazella bennettii - 71) and 284 fecal samples of domestic herbivores (cattle - 118, buffalo - 78, and goat - 88) were collected from common grazing land and adjoining area of tiger reserve. Detailed coprological examination for the presence of parasitic eggs/oocysts by direct smear examination, standard sedimentation, and floatation techniques was performed. RESULTS: Fecal samples (n=374) of four different species of wild herbivores were screened. Out of which, 55.61% (n=208) were positive for parasitic infection. Among them, 13.10% (n=49) were positive for mixed parasitic infection of two or more parasite and 42.5% (n=159) were found positive for single parasitic infection. A total of 284 fecal samples of domestic animals were screened from adjoining areas of the tiger reserve. Out of which, 66.54% (n=189) were positive for parasitic infections, out of which 19.71% (n=56) were positive for mixed infection of two or more parasites, and 46.83% (n=133) were found positive for single parasitic infection. CONCLUSION: Wild herbivores at Panna Tiger Reserve were exposed to parasites including some that are known to be pathogenic; majority of wild animals had mixed infection of Eimeria spp., Trichuris spp., Moniezia spp., Amphistome, Strongyloides spp., Balantidium spp., and Fasciola spp. |
format | Online Article Text |
id | pubmed-5553141 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2017 |
publisher | Veterinary World |
record_format | MEDLINE/PubMed |
spelling | pubmed-55531412017-08-22 Noninvasive assessment of gastrointestinal parasites infection in free-ranging wild herbivores and adjoining livestock of Panna Tiger Reserve, Madhya Pradesh, India Sengar, Abhay Shrivastav, A. B. Singh, K. P. Rokde, Amol Vet World Research Article AIM: This study was conducted to know the epidemiology of gastrointestinal parasites of free-ranging wild herbivores and adjoining livestock of Panna Tiger Reserve, Madhya Pradesh, India. MATERIALS AND METHODS: A total of 374 fecal samples from wild herbivores (Chital Axis axis - 123, Sambar Rusa unicolor - 94, Nilgai Boselaphus tragocamelus - 86, and Chinkara Gazella bennettii - 71) and 284 fecal samples of domestic herbivores (cattle - 118, buffalo - 78, and goat - 88) were collected from common grazing land and adjoining area of tiger reserve. Detailed coprological examination for the presence of parasitic eggs/oocysts by direct smear examination, standard sedimentation, and floatation techniques was performed. RESULTS: Fecal samples (n=374) of four different species of wild herbivores were screened. Out of which, 55.61% (n=208) were positive for parasitic infection. Among them, 13.10% (n=49) were positive for mixed parasitic infection of two or more parasite and 42.5% (n=159) were found positive for single parasitic infection. A total of 284 fecal samples of domestic animals were screened from adjoining areas of the tiger reserve. Out of which, 66.54% (n=189) were positive for parasitic infections, out of which 19.71% (n=56) were positive for mixed infection of two or more parasites, and 46.83% (n=133) were found positive for single parasitic infection. CONCLUSION: Wild herbivores at Panna Tiger Reserve were exposed to parasites including some that are known to be pathogenic; majority of wild animals had mixed infection of Eimeria spp., Trichuris spp., Moniezia spp., Amphistome, Strongyloides spp., Balantidium spp., and Fasciola spp. Veterinary World 2017-07 2017-07-06 /pmc/articles/PMC5553141/ /pubmed/28831216 http://dx.doi.org/10.14202/vetworld.2017.748-751 Text en Copyright: © Sengar, et al. http://creativecommons.org/licenses/by/4.0 Open Access. This article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Article Sengar, Abhay Shrivastav, A. B. Singh, K. P. Rokde, Amol Noninvasive assessment of gastrointestinal parasites infection in free-ranging wild herbivores and adjoining livestock of Panna Tiger Reserve, Madhya Pradesh, India |
title | Noninvasive assessment of gastrointestinal parasites infection in free-ranging wild herbivores and adjoining livestock of Panna Tiger Reserve, Madhya Pradesh, India |
title_full | Noninvasive assessment of gastrointestinal parasites infection in free-ranging wild herbivores and adjoining livestock of Panna Tiger Reserve, Madhya Pradesh, India |
title_fullStr | Noninvasive assessment of gastrointestinal parasites infection in free-ranging wild herbivores and adjoining livestock of Panna Tiger Reserve, Madhya Pradesh, India |
title_full_unstemmed | Noninvasive assessment of gastrointestinal parasites infection in free-ranging wild herbivores and adjoining livestock of Panna Tiger Reserve, Madhya Pradesh, India |
title_short | Noninvasive assessment of gastrointestinal parasites infection in free-ranging wild herbivores and adjoining livestock of Panna Tiger Reserve, Madhya Pradesh, India |
title_sort | noninvasive assessment of gastrointestinal parasites infection in free-ranging wild herbivores and adjoining livestock of panna tiger reserve, madhya pradesh, india |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5553141/ https://www.ncbi.nlm.nih.gov/pubmed/28831216 http://dx.doi.org/10.14202/vetworld.2017.748-751 |
work_keys_str_mv | AT sengarabhay noninvasiveassessmentofgastrointestinalparasitesinfectioninfreerangingwildherbivoresandadjoininglivestockofpannatigerreservemadhyapradeshindia AT shrivastavab noninvasiveassessmentofgastrointestinalparasitesinfectioninfreerangingwildherbivoresandadjoininglivestockofpannatigerreservemadhyapradeshindia AT singhkp noninvasiveassessmentofgastrointestinalparasitesinfectioninfreerangingwildherbivoresandadjoininglivestockofpannatigerreservemadhyapradeshindia AT rokdeamol noninvasiveassessmentofgastrointestinalparasitesinfectioninfreerangingwildherbivoresandadjoininglivestockofpannatigerreservemadhyapradeshindia |