Cargando…
The Catsper channel and its roles in male fertility: a systematic review
The Catsper channel is a sperm-specific, Ca(2+)-permeable, pH-dependent, and low voltage-dependent channel that is essential for the hyperactivity of sperm flagellum, chemotaxis towards the egg, capacitation and acrosome reaction. All of these physiological events require calcium entry into sperm ce...
Autores principales: | , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2017
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5558725/ https://www.ncbi.nlm.nih.gov/pubmed/28810916 http://dx.doi.org/10.1186/s12958-017-0281-2 |
_version_ | 1783257436301295616 |
---|---|
author | Sun, Xiang-hong Zhu, Ying-ying Wang, Lin Liu, Hong-ling Ling, Yong Li, Zong-li Sun, Li-bo |
author_facet | Sun, Xiang-hong Zhu, Ying-ying Wang, Lin Liu, Hong-ling Ling, Yong Li, Zong-li Sun, Li-bo |
author_sort | Sun, Xiang-hong |
collection | PubMed |
description | The Catsper channel is a sperm-specific, Ca(2+)-permeable, pH-dependent, and low voltage-dependent channel that is essential for the hyperactivity of sperm flagellum, chemotaxis towards the egg, capacitation and acrosome reaction. All of these physiological events require calcium entry into sperm cells. Remarkably, Catsper genes are exclusively expressed in the testis during spermatogenesis, and are sensitive to ion channel-induced pH change, such as NHEs, Ca(2+)ATPase, K(+) channel, Hv1 channel and HCO(3) (−) transporters. Furthermore, the Catsper channel is regulated by some physiological stimulants, such as progesterone, cyclic nucleotides (e.g., cAMP, cGMP), zona pellucida (ZP) glycoproteins and bovine serum albumin (BSA). All of these factors normally stimulate Ca(2+) entry into sperm through the Catsper channel. In addition, the Catsper channel may be a potential target for male infertility treatment or contraception. This review will focus on the structure, functions, regulation mechanisms and medicinal targets of the Catsper channel. |
format | Online Article Text |
id | pubmed-5558725 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2017 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-55587252017-08-18 The Catsper channel and its roles in male fertility: a systematic review Sun, Xiang-hong Zhu, Ying-ying Wang, Lin Liu, Hong-ling Ling, Yong Li, Zong-li Sun, Li-bo Reprod Biol Endocrinol Review The Catsper channel is a sperm-specific, Ca(2+)-permeable, pH-dependent, and low voltage-dependent channel that is essential for the hyperactivity of sperm flagellum, chemotaxis towards the egg, capacitation and acrosome reaction. All of these physiological events require calcium entry into sperm cells. Remarkably, Catsper genes are exclusively expressed in the testis during spermatogenesis, and are sensitive to ion channel-induced pH change, such as NHEs, Ca(2+)ATPase, K(+) channel, Hv1 channel and HCO(3) (−) transporters. Furthermore, the Catsper channel is regulated by some physiological stimulants, such as progesterone, cyclic nucleotides (e.g., cAMP, cGMP), zona pellucida (ZP) glycoproteins and bovine serum albumin (BSA). All of these factors normally stimulate Ca(2+) entry into sperm through the Catsper channel. In addition, the Catsper channel may be a potential target for male infertility treatment or contraception. This review will focus on the structure, functions, regulation mechanisms and medicinal targets of the Catsper channel. BioMed Central 2017-08-15 /pmc/articles/PMC5558725/ /pubmed/28810916 http://dx.doi.org/10.1186/s12958-017-0281-2 Text en © The Author(s). 2017 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Review Sun, Xiang-hong Zhu, Ying-ying Wang, Lin Liu, Hong-ling Ling, Yong Li, Zong-li Sun, Li-bo The Catsper channel and its roles in male fertility: a systematic review |
title | The Catsper channel and its roles in male fertility: a systematic review |
title_full | The Catsper channel and its roles in male fertility: a systematic review |
title_fullStr | The Catsper channel and its roles in male fertility: a systematic review |
title_full_unstemmed | The Catsper channel and its roles in male fertility: a systematic review |
title_short | The Catsper channel and its roles in male fertility: a systematic review |
title_sort | catsper channel and its roles in male fertility: a systematic review |
topic | Review |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5558725/ https://www.ncbi.nlm.nih.gov/pubmed/28810916 http://dx.doi.org/10.1186/s12958-017-0281-2 |
work_keys_str_mv | AT sunxianghong thecatsperchannelanditsrolesinmalefertilityasystematicreview AT zhuyingying thecatsperchannelanditsrolesinmalefertilityasystematicreview AT wanglin thecatsperchannelanditsrolesinmalefertilityasystematicreview AT liuhongling thecatsperchannelanditsrolesinmalefertilityasystematicreview AT lingyong thecatsperchannelanditsrolesinmalefertilityasystematicreview AT lizongli thecatsperchannelanditsrolesinmalefertilityasystematicreview AT sunlibo thecatsperchannelanditsrolesinmalefertilityasystematicreview AT sunxianghong catsperchannelanditsrolesinmalefertilityasystematicreview AT zhuyingying catsperchannelanditsrolesinmalefertilityasystematicreview AT wanglin catsperchannelanditsrolesinmalefertilityasystematicreview AT liuhongling catsperchannelanditsrolesinmalefertilityasystematicreview AT lingyong catsperchannelanditsrolesinmalefertilityasystematicreview AT lizongli catsperchannelanditsrolesinmalefertilityasystematicreview AT sunlibo catsperchannelanditsrolesinmalefertilityasystematicreview |