Cargando…

The Catsper channel and its roles in male fertility: a systematic review

The Catsper channel is a sperm-specific, Ca(2+)-permeable, pH-dependent, and low voltage-dependent channel that is essential for the hyperactivity of sperm flagellum, chemotaxis towards the egg, capacitation and acrosome reaction. All of these physiological events require calcium entry into sperm ce...

Descripción completa

Detalles Bibliográficos
Autores principales: Sun, Xiang-hong, Zhu, Ying-ying, Wang, Lin, Liu, Hong-ling, Ling, Yong, Li, Zong-li, Sun, Li-bo
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2017
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5558725/
https://www.ncbi.nlm.nih.gov/pubmed/28810916
http://dx.doi.org/10.1186/s12958-017-0281-2
_version_ 1783257436301295616
author Sun, Xiang-hong
Zhu, Ying-ying
Wang, Lin
Liu, Hong-ling
Ling, Yong
Li, Zong-li
Sun, Li-bo
author_facet Sun, Xiang-hong
Zhu, Ying-ying
Wang, Lin
Liu, Hong-ling
Ling, Yong
Li, Zong-li
Sun, Li-bo
author_sort Sun, Xiang-hong
collection PubMed
description The Catsper channel is a sperm-specific, Ca(2+)-permeable, pH-dependent, and low voltage-dependent channel that is essential for the hyperactivity of sperm flagellum, chemotaxis towards the egg, capacitation and acrosome reaction. All of these physiological events require calcium entry into sperm cells. Remarkably, Catsper genes are exclusively expressed in the testis during spermatogenesis, and are sensitive to ion channel-induced pH change, such as NHEs, Ca(2+)ATPase, K(+) channel, Hv1 channel and HCO(3) (−) transporters. Furthermore, the Catsper channel is regulated by some physiological stimulants, such as progesterone, cyclic nucleotides (e.g., cAMP, cGMP), zona pellucida (ZP) glycoproteins and bovine serum albumin (BSA). All of these factors normally stimulate Ca(2+) entry into sperm through the Catsper channel. In addition, the Catsper channel may be a potential target for male infertility treatment or contraception. This review will focus on the structure, functions, regulation mechanisms and medicinal targets of the Catsper channel.
format Online
Article
Text
id pubmed-5558725
institution National Center for Biotechnology Information
language English
publishDate 2017
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-55587252017-08-18 The Catsper channel and its roles in male fertility: a systematic review Sun, Xiang-hong Zhu, Ying-ying Wang, Lin Liu, Hong-ling Ling, Yong Li, Zong-li Sun, Li-bo Reprod Biol Endocrinol Review The Catsper channel is a sperm-specific, Ca(2+)-permeable, pH-dependent, and low voltage-dependent channel that is essential for the hyperactivity of sperm flagellum, chemotaxis towards the egg, capacitation and acrosome reaction. All of these physiological events require calcium entry into sperm cells. Remarkably, Catsper genes are exclusively expressed in the testis during spermatogenesis, and are sensitive to ion channel-induced pH change, such as NHEs, Ca(2+)ATPase, K(+) channel, Hv1 channel and HCO(3) (−) transporters. Furthermore, the Catsper channel is regulated by some physiological stimulants, such as progesterone, cyclic nucleotides (e.g., cAMP, cGMP), zona pellucida (ZP) glycoproteins and bovine serum albumin (BSA). All of these factors normally stimulate Ca(2+) entry into sperm through the Catsper channel. In addition, the Catsper channel may be a potential target for male infertility treatment or contraception. This review will focus on the structure, functions, regulation mechanisms and medicinal targets of the Catsper channel. BioMed Central 2017-08-15 /pmc/articles/PMC5558725/ /pubmed/28810916 http://dx.doi.org/10.1186/s12958-017-0281-2 Text en © The Author(s). 2017 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Review
Sun, Xiang-hong
Zhu, Ying-ying
Wang, Lin
Liu, Hong-ling
Ling, Yong
Li, Zong-li
Sun, Li-bo
The Catsper channel and its roles in male fertility: a systematic review
title The Catsper channel and its roles in male fertility: a systematic review
title_full The Catsper channel and its roles in male fertility: a systematic review
title_fullStr The Catsper channel and its roles in male fertility: a systematic review
title_full_unstemmed The Catsper channel and its roles in male fertility: a systematic review
title_short The Catsper channel and its roles in male fertility: a systematic review
title_sort catsper channel and its roles in male fertility: a systematic review
topic Review
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5558725/
https://www.ncbi.nlm.nih.gov/pubmed/28810916
http://dx.doi.org/10.1186/s12958-017-0281-2
work_keys_str_mv AT sunxianghong thecatsperchannelanditsrolesinmalefertilityasystematicreview
AT zhuyingying thecatsperchannelanditsrolesinmalefertilityasystematicreview
AT wanglin thecatsperchannelanditsrolesinmalefertilityasystematicreview
AT liuhongling thecatsperchannelanditsrolesinmalefertilityasystematicreview
AT lingyong thecatsperchannelanditsrolesinmalefertilityasystematicreview
AT lizongli thecatsperchannelanditsrolesinmalefertilityasystematicreview
AT sunlibo thecatsperchannelanditsrolesinmalefertilityasystematicreview
AT sunxianghong catsperchannelanditsrolesinmalefertilityasystematicreview
AT zhuyingying catsperchannelanditsrolesinmalefertilityasystematicreview
AT wanglin catsperchannelanditsrolesinmalefertilityasystematicreview
AT liuhongling catsperchannelanditsrolesinmalefertilityasystematicreview
AT lingyong catsperchannelanditsrolesinmalefertilityasystematicreview
AT lizongli catsperchannelanditsrolesinmalefertilityasystematicreview
AT sunlibo catsperchannelanditsrolesinmalefertilityasystematicreview