Cargando…
Perspectives of basic wheelchair users on improving their access to wheelchair services in Kenya and Philippines: a qualitative study
BACKGROUND: The United Nations has called for countries to improve access to mobility devices when needed. The World Health Organization has published guidelines on the provision of manual wheelchairs in less-resourced settings. Yet little is known about the extent to which appropriate wheelchairs a...
Autores principales: | , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2017
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5561585/ https://www.ncbi.nlm.nih.gov/pubmed/28818075 http://dx.doi.org/10.1186/s12914-017-0130-6 |
_version_ | 1783257856273809408 |
---|---|
author | Williams, Emma Hurwitz, Elizabeth Obaga, Immaculate Onguti, Brenda Rivera, Adovich Sy, Tyrone Reden L. Kirby, R. Lee Noon, Jamie Tanuku, Deepti Gichangi, Anthony Bazant, Eva |
author_facet | Williams, Emma Hurwitz, Elizabeth Obaga, Immaculate Onguti, Brenda Rivera, Adovich Sy, Tyrone Reden L. Kirby, R. Lee Noon, Jamie Tanuku, Deepti Gichangi, Anthony Bazant, Eva |
author_sort | Williams, Emma |
collection | PubMed |
description | BACKGROUND: The United Nations has called for countries to improve access to mobility devices when needed. The World Health Organization has published guidelines on the provision of manual wheelchairs in less-resourced settings. Yet little is known about the extent to which appropriate wheelchairs are available and provided according to international guidelines. This study’s purpose was to describe wheelchair users’ experiences receiving services and acquiring wheelchair skills in urban and peri-urban areas of Kenya and the Philippines. METHODS: Local researchers in Nairobi and Manila interviewed 48 adult basic wheelchair users, with even distribution of those who had and had not received wheelchair services along with their wheelchair. Recordings were transcribed in the local language and translated into English. The study team coded transcripts for predetermined and emergent themes, using Atlas-ti software. A qualitative content analysis approach was taken with the WHO service delivery process as an organizing framework. RESULTS: Wheelchair users frequently described past experiences with ill-fitting wheelchairs and little formal training to use wheelchairs effectively. Through exposure to multiple wheelchairs and self-advocacy, they learned to select wheelchairs suitable for their needs. Maintenance and repair services were often in short supply. Participants attributed shorter duration of wheelchair use to lack of repair. Peer support networks emerged as an important source of knowledge, resources and emotional support. Most participants acknowledged that they received wheelchairs that would have been difficult or impossible for them to pay for, and despite challenges, they were grateful to have some means of mobility. Four themes emerged as critical for understanding the implementation of wheelchair services: barriers in the physical environment, the need for having multiple chairs to improve access, perceived social stigma, and the importance of peer support. CONCLUSIONS: Interventions are needed to provide wheelchairs services efficiently, at scale, in an environment facilitating physical access and peer support, and reduced social stigma. TRIAL REGISTRATION: Not applicable since this was a descriptive study. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s12914-017-0130-6) contains supplementary material, which is available to authorized users. |
format | Online Article Text |
id | pubmed-5561585 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2017 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-55615852017-08-18 Perspectives of basic wheelchair users on improving their access to wheelchair services in Kenya and Philippines: a qualitative study Williams, Emma Hurwitz, Elizabeth Obaga, Immaculate Onguti, Brenda Rivera, Adovich Sy, Tyrone Reden L. Kirby, R. Lee Noon, Jamie Tanuku, Deepti Gichangi, Anthony Bazant, Eva BMC Int Health Hum Rights Research Article BACKGROUND: The United Nations has called for countries to improve access to mobility devices when needed. The World Health Organization has published guidelines on the provision of manual wheelchairs in less-resourced settings. Yet little is known about the extent to which appropriate wheelchairs are available and provided according to international guidelines. This study’s purpose was to describe wheelchair users’ experiences receiving services and acquiring wheelchair skills in urban and peri-urban areas of Kenya and the Philippines. METHODS: Local researchers in Nairobi and Manila interviewed 48 adult basic wheelchair users, with even distribution of those who had and had not received wheelchair services along with their wheelchair. Recordings were transcribed in the local language and translated into English. The study team coded transcripts for predetermined and emergent themes, using Atlas-ti software. A qualitative content analysis approach was taken with the WHO service delivery process as an organizing framework. RESULTS: Wheelchair users frequently described past experiences with ill-fitting wheelchairs and little formal training to use wheelchairs effectively. Through exposure to multiple wheelchairs and self-advocacy, they learned to select wheelchairs suitable for their needs. Maintenance and repair services were often in short supply. Participants attributed shorter duration of wheelchair use to lack of repair. Peer support networks emerged as an important source of knowledge, resources and emotional support. Most participants acknowledged that they received wheelchairs that would have been difficult or impossible for them to pay for, and despite challenges, they were grateful to have some means of mobility. Four themes emerged as critical for understanding the implementation of wheelchair services: barriers in the physical environment, the need for having multiple chairs to improve access, perceived social stigma, and the importance of peer support. CONCLUSIONS: Interventions are needed to provide wheelchairs services efficiently, at scale, in an environment facilitating physical access and peer support, and reduced social stigma. TRIAL REGISTRATION: Not applicable since this was a descriptive study. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s12914-017-0130-6) contains supplementary material, which is available to authorized users. BioMed Central 2017-08-17 /pmc/articles/PMC5561585/ /pubmed/28818075 http://dx.doi.org/10.1186/s12914-017-0130-6 Text en © The Author(s). 2017 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Article Williams, Emma Hurwitz, Elizabeth Obaga, Immaculate Onguti, Brenda Rivera, Adovich Sy, Tyrone Reden L. Kirby, R. Lee Noon, Jamie Tanuku, Deepti Gichangi, Anthony Bazant, Eva Perspectives of basic wheelchair users on improving their access to wheelchair services in Kenya and Philippines: a qualitative study |
title | Perspectives of basic wheelchair users on improving their access to wheelchair services in Kenya and Philippines: a qualitative study |
title_full | Perspectives of basic wheelchair users on improving their access to wheelchair services in Kenya and Philippines: a qualitative study |
title_fullStr | Perspectives of basic wheelchair users on improving their access to wheelchair services in Kenya and Philippines: a qualitative study |
title_full_unstemmed | Perspectives of basic wheelchair users on improving their access to wheelchair services in Kenya and Philippines: a qualitative study |
title_short | Perspectives of basic wheelchair users on improving their access to wheelchair services in Kenya and Philippines: a qualitative study |
title_sort | perspectives of basic wheelchair users on improving their access to wheelchair services in kenya and philippines: a qualitative study |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5561585/ https://www.ncbi.nlm.nih.gov/pubmed/28818075 http://dx.doi.org/10.1186/s12914-017-0130-6 |
work_keys_str_mv | AT williamsemma perspectivesofbasicwheelchairusersonimprovingtheiraccesstowheelchairservicesinkenyaandphilippinesaqualitativestudy AT hurwitzelizabeth perspectivesofbasicwheelchairusersonimprovingtheiraccesstowheelchairservicesinkenyaandphilippinesaqualitativestudy AT obagaimmaculate perspectivesofbasicwheelchairusersonimprovingtheiraccesstowheelchairservicesinkenyaandphilippinesaqualitativestudy AT ongutibrenda perspectivesofbasicwheelchairusersonimprovingtheiraccesstowheelchairservicesinkenyaandphilippinesaqualitativestudy AT riveraadovich perspectivesofbasicwheelchairusersonimprovingtheiraccesstowheelchairservicesinkenyaandphilippinesaqualitativestudy AT sytyroneredenl perspectivesofbasicwheelchairusersonimprovingtheiraccesstowheelchairservicesinkenyaandphilippinesaqualitativestudy AT kirbyrlee perspectivesofbasicwheelchairusersonimprovingtheiraccesstowheelchairservicesinkenyaandphilippinesaqualitativestudy AT noonjamie perspectivesofbasicwheelchairusersonimprovingtheiraccesstowheelchairservicesinkenyaandphilippinesaqualitativestudy AT tanukudeepti perspectivesofbasicwheelchairusersonimprovingtheiraccesstowheelchairservicesinkenyaandphilippinesaqualitativestudy AT gichangianthony perspectivesofbasicwheelchairusersonimprovingtheiraccesstowheelchairservicesinkenyaandphilippinesaqualitativestudy AT bazanteva perspectivesofbasicwheelchairusersonimprovingtheiraccesstowheelchairservicesinkenyaandphilippinesaqualitativestudy |