Cargando…
The adenosine A2b receptor promotes tumor progression of bladder urothelial carcinoma by enhancing MAPK signaling pathway
The adenosine A2b receptor (A2bR) was considered to play an oncogenic role in many human malignancies. However, the expression and molecular function of A2bR in bladder urothelial carcinoma (BUC) have not been well elucidated. Herein, we found that the expression of A2bR was higher than other adenos...
Autores principales: | , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Impact Journals LLC
2017
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5564722/ https://www.ncbi.nlm.nih.gov/pubmed/28548944 http://dx.doi.org/10.18632/oncotarget.17835 |
_version_ | 1783258287953674240 |
---|---|
author | Zhou, Yihong Chu, Xi Deng, Fei Tong, Liang Tong, Guoxiong Yi, Ye Liu, Jianye Tang, Jin Tang, Yuxin Xia, Yang Dai, Yingbo |
author_facet | Zhou, Yihong Chu, Xi Deng, Fei Tong, Liang Tong, Guoxiong Yi, Ye Liu, Jianye Tang, Jin Tang, Yuxin Xia, Yang Dai, Yingbo |
author_sort | Zhou, Yihong |
collection | PubMed |
description | The adenosine A2b receptor (A2bR) was considered to play an oncogenic role in many human malignancies. However, the expression and molecular function of A2bR in bladder urothelial carcinoma (BUC) have not been well elucidated. Herein, we found that the expression of A2bR was higher than other adenosine receptors in BUC tissues and cells, and it was upregulated in BUC tissues compared with matched normal bladder tissues. Furthermore, high expression of A2bR was associated with poor prognosis of patients with BUC. In addition, suppression of A2bR inhibited the proliferation, migration and invasion of BUC cells and arrested the cell cycle at the G1 phase. Finally, we demonstrated that downregulation of A2bR inhibited the proliferation, migration and invasion of BUC in part via the MAPK signaling pathway, increasing the levels of P21 but decreasing the levels of cyclin B1, D, E1, MMP-2 and MMP-9. Overexpression of MMP-2 could rescue BUC cells migration and invasion. Thus, the present study indicates that A2bR may play a potential oncogenic role in BUC progression and act as a potential biomarker to identify BUC patients with poor clinical outcomes. |
format | Online Article Text |
id | pubmed-5564722 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2017 |
publisher | Impact Journals LLC |
record_format | MEDLINE/PubMed |
spelling | pubmed-55647222017-08-23 The adenosine A2b receptor promotes tumor progression of bladder urothelial carcinoma by enhancing MAPK signaling pathway Zhou, Yihong Chu, Xi Deng, Fei Tong, Liang Tong, Guoxiong Yi, Ye Liu, Jianye Tang, Jin Tang, Yuxin Xia, Yang Dai, Yingbo Oncotarget Research Paper The adenosine A2b receptor (A2bR) was considered to play an oncogenic role in many human malignancies. However, the expression and molecular function of A2bR in bladder urothelial carcinoma (BUC) have not been well elucidated. Herein, we found that the expression of A2bR was higher than other adenosine receptors in BUC tissues and cells, and it was upregulated in BUC tissues compared with matched normal bladder tissues. Furthermore, high expression of A2bR was associated with poor prognosis of patients with BUC. In addition, suppression of A2bR inhibited the proliferation, migration and invasion of BUC cells and arrested the cell cycle at the G1 phase. Finally, we demonstrated that downregulation of A2bR inhibited the proliferation, migration and invasion of BUC in part via the MAPK signaling pathway, increasing the levels of P21 but decreasing the levels of cyclin B1, D, E1, MMP-2 and MMP-9. Overexpression of MMP-2 could rescue BUC cells migration and invasion. Thus, the present study indicates that A2bR may play a potential oncogenic role in BUC progression and act as a potential biomarker to identify BUC patients with poor clinical outcomes. Impact Journals LLC 2017-05-12 /pmc/articles/PMC5564722/ /pubmed/28548944 http://dx.doi.org/10.18632/oncotarget.17835 Text en Copyright: © 2017 Zhou et al. http://creativecommons.org/licenses/by/3.0/ This article is distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/3.0/) (CC-BY), which permits unrestricted use and redistribution provided that the original author and source are credited. |
spellingShingle | Research Paper Zhou, Yihong Chu, Xi Deng, Fei Tong, Liang Tong, Guoxiong Yi, Ye Liu, Jianye Tang, Jin Tang, Yuxin Xia, Yang Dai, Yingbo The adenosine A2b receptor promotes tumor progression of bladder urothelial carcinoma by enhancing MAPK signaling pathway |
title | The adenosine A2b receptor promotes tumor progression of bladder urothelial carcinoma by enhancing MAPK signaling pathway |
title_full | The adenosine A2b receptor promotes tumor progression of bladder urothelial carcinoma by enhancing MAPK signaling pathway |
title_fullStr | The adenosine A2b receptor promotes tumor progression of bladder urothelial carcinoma by enhancing MAPK signaling pathway |
title_full_unstemmed | The adenosine A2b receptor promotes tumor progression of bladder urothelial carcinoma by enhancing MAPK signaling pathway |
title_short | The adenosine A2b receptor promotes tumor progression of bladder urothelial carcinoma by enhancing MAPK signaling pathway |
title_sort | adenosine a2b receptor promotes tumor progression of bladder urothelial carcinoma by enhancing mapk signaling pathway |
topic | Research Paper |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5564722/ https://www.ncbi.nlm.nih.gov/pubmed/28548944 http://dx.doi.org/10.18632/oncotarget.17835 |
work_keys_str_mv | AT zhouyihong theadenosinea2breceptorpromotestumorprogressionofbladderurothelialcarcinomabyenhancingmapksignalingpathway AT chuxi theadenosinea2breceptorpromotestumorprogressionofbladderurothelialcarcinomabyenhancingmapksignalingpathway AT dengfei theadenosinea2breceptorpromotestumorprogressionofbladderurothelialcarcinomabyenhancingmapksignalingpathway AT tongliang theadenosinea2breceptorpromotestumorprogressionofbladderurothelialcarcinomabyenhancingmapksignalingpathway AT tongguoxiong theadenosinea2breceptorpromotestumorprogressionofbladderurothelialcarcinomabyenhancingmapksignalingpathway AT yiye theadenosinea2breceptorpromotestumorprogressionofbladderurothelialcarcinomabyenhancingmapksignalingpathway AT liujianye theadenosinea2breceptorpromotestumorprogressionofbladderurothelialcarcinomabyenhancingmapksignalingpathway AT tangjin theadenosinea2breceptorpromotestumorprogressionofbladderurothelialcarcinomabyenhancingmapksignalingpathway AT tangyuxin theadenosinea2breceptorpromotestumorprogressionofbladderurothelialcarcinomabyenhancingmapksignalingpathway AT xiayang theadenosinea2breceptorpromotestumorprogressionofbladderurothelialcarcinomabyenhancingmapksignalingpathway AT daiyingbo theadenosinea2breceptorpromotestumorprogressionofbladderurothelialcarcinomabyenhancingmapksignalingpathway AT zhouyihong adenosinea2breceptorpromotestumorprogressionofbladderurothelialcarcinomabyenhancingmapksignalingpathway AT chuxi adenosinea2breceptorpromotestumorprogressionofbladderurothelialcarcinomabyenhancingmapksignalingpathway AT dengfei adenosinea2breceptorpromotestumorprogressionofbladderurothelialcarcinomabyenhancingmapksignalingpathway AT tongliang adenosinea2breceptorpromotestumorprogressionofbladderurothelialcarcinomabyenhancingmapksignalingpathway AT tongguoxiong adenosinea2breceptorpromotestumorprogressionofbladderurothelialcarcinomabyenhancingmapksignalingpathway AT yiye adenosinea2breceptorpromotestumorprogressionofbladderurothelialcarcinomabyenhancingmapksignalingpathway AT liujianye adenosinea2breceptorpromotestumorprogressionofbladderurothelialcarcinomabyenhancingmapksignalingpathway AT tangjin adenosinea2breceptorpromotestumorprogressionofbladderurothelialcarcinomabyenhancingmapksignalingpathway AT tangyuxin adenosinea2breceptorpromotestumorprogressionofbladderurothelialcarcinomabyenhancingmapksignalingpathway AT xiayang adenosinea2breceptorpromotestumorprogressionofbladderurothelialcarcinomabyenhancingmapksignalingpathway AT daiyingbo adenosinea2breceptorpromotestumorprogressionofbladderurothelialcarcinomabyenhancingmapksignalingpathway |