Cargando…

The adenosine A2b receptor promotes tumor progression of bladder urothelial carcinoma by enhancing MAPK signaling pathway

The adenosine A2b receptor (A2bR) was considered to play an oncogenic role in many human malignancies. However, the expression and molecular function of A2bR in bladder urothelial carcinoma (BUC) have not been well elucidated. Herein, we found that the expression of A2bR was higher than other adenos...

Descripción completa

Detalles Bibliográficos
Autores principales: Zhou, Yihong, Chu, Xi, Deng, Fei, Tong, Liang, Tong, Guoxiong, Yi, Ye, Liu, Jianye, Tang, Jin, Tang, Yuxin, Xia, Yang, Dai, Yingbo
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Impact Journals LLC 2017
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5564722/
https://www.ncbi.nlm.nih.gov/pubmed/28548944
http://dx.doi.org/10.18632/oncotarget.17835
_version_ 1783258287953674240
author Zhou, Yihong
Chu, Xi
Deng, Fei
Tong, Liang
Tong, Guoxiong
Yi, Ye
Liu, Jianye
Tang, Jin
Tang, Yuxin
Xia, Yang
Dai, Yingbo
author_facet Zhou, Yihong
Chu, Xi
Deng, Fei
Tong, Liang
Tong, Guoxiong
Yi, Ye
Liu, Jianye
Tang, Jin
Tang, Yuxin
Xia, Yang
Dai, Yingbo
author_sort Zhou, Yihong
collection PubMed
description The adenosine A2b receptor (A2bR) was considered to play an oncogenic role in many human malignancies. However, the expression and molecular function of A2bR in bladder urothelial carcinoma (BUC) have not been well elucidated. Herein, we found that the expression of A2bR was higher than other adenosine receptors in BUC tissues and cells, and it was upregulated in BUC tissues compared with matched normal bladder tissues. Furthermore, high expression of A2bR was associated with poor prognosis of patients with BUC. In addition, suppression of A2bR inhibited the proliferation, migration and invasion of BUC cells and arrested the cell cycle at the G1 phase. Finally, we demonstrated that downregulation of A2bR inhibited the proliferation, migration and invasion of BUC in part via the MAPK signaling pathway, increasing the levels of P21 but decreasing the levels of cyclin B1, D, E1, MMP-2 and MMP-9. Overexpression of MMP-2 could rescue BUC cells migration and invasion. Thus, the present study indicates that A2bR may play a potential oncogenic role in BUC progression and act as a potential biomarker to identify BUC patients with poor clinical outcomes.
format Online
Article
Text
id pubmed-5564722
institution National Center for Biotechnology Information
language English
publishDate 2017
publisher Impact Journals LLC
record_format MEDLINE/PubMed
spelling pubmed-55647222017-08-23 The adenosine A2b receptor promotes tumor progression of bladder urothelial carcinoma by enhancing MAPK signaling pathway Zhou, Yihong Chu, Xi Deng, Fei Tong, Liang Tong, Guoxiong Yi, Ye Liu, Jianye Tang, Jin Tang, Yuxin Xia, Yang Dai, Yingbo Oncotarget Research Paper The adenosine A2b receptor (A2bR) was considered to play an oncogenic role in many human malignancies. However, the expression and molecular function of A2bR in bladder urothelial carcinoma (BUC) have not been well elucidated. Herein, we found that the expression of A2bR was higher than other adenosine receptors in BUC tissues and cells, and it was upregulated in BUC tissues compared with matched normal bladder tissues. Furthermore, high expression of A2bR was associated with poor prognosis of patients with BUC. In addition, suppression of A2bR inhibited the proliferation, migration and invasion of BUC cells and arrested the cell cycle at the G1 phase. Finally, we demonstrated that downregulation of A2bR inhibited the proliferation, migration and invasion of BUC in part via the MAPK signaling pathway, increasing the levels of P21 but decreasing the levels of cyclin B1, D, E1, MMP-2 and MMP-9. Overexpression of MMP-2 could rescue BUC cells migration and invasion. Thus, the present study indicates that A2bR may play a potential oncogenic role in BUC progression and act as a potential biomarker to identify BUC patients with poor clinical outcomes. Impact Journals LLC 2017-05-12 /pmc/articles/PMC5564722/ /pubmed/28548944 http://dx.doi.org/10.18632/oncotarget.17835 Text en Copyright: © 2017 Zhou et al. http://creativecommons.org/licenses/by/3.0/ This article is distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/3.0/) (CC-BY), which permits unrestricted use and redistribution provided that the original author and source are credited.
spellingShingle Research Paper
Zhou, Yihong
Chu, Xi
Deng, Fei
Tong, Liang
Tong, Guoxiong
Yi, Ye
Liu, Jianye
Tang, Jin
Tang, Yuxin
Xia, Yang
Dai, Yingbo
The adenosine A2b receptor promotes tumor progression of bladder urothelial carcinoma by enhancing MAPK signaling pathway
title The adenosine A2b receptor promotes tumor progression of bladder urothelial carcinoma by enhancing MAPK signaling pathway
title_full The adenosine A2b receptor promotes tumor progression of bladder urothelial carcinoma by enhancing MAPK signaling pathway
title_fullStr The adenosine A2b receptor promotes tumor progression of bladder urothelial carcinoma by enhancing MAPK signaling pathway
title_full_unstemmed The adenosine A2b receptor promotes tumor progression of bladder urothelial carcinoma by enhancing MAPK signaling pathway
title_short The adenosine A2b receptor promotes tumor progression of bladder urothelial carcinoma by enhancing MAPK signaling pathway
title_sort adenosine a2b receptor promotes tumor progression of bladder urothelial carcinoma by enhancing mapk signaling pathway
topic Research Paper
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5564722/
https://www.ncbi.nlm.nih.gov/pubmed/28548944
http://dx.doi.org/10.18632/oncotarget.17835
work_keys_str_mv AT zhouyihong theadenosinea2breceptorpromotestumorprogressionofbladderurothelialcarcinomabyenhancingmapksignalingpathway
AT chuxi theadenosinea2breceptorpromotestumorprogressionofbladderurothelialcarcinomabyenhancingmapksignalingpathway
AT dengfei theadenosinea2breceptorpromotestumorprogressionofbladderurothelialcarcinomabyenhancingmapksignalingpathway
AT tongliang theadenosinea2breceptorpromotestumorprogressionofbladderurothelialcarcinomabyenhancingmapksignalingpathway
AT tongguoxiong theadenosinea2breceptorpromotestumorprogressionofbladderurothelialcarcinomabyenhancingmapksignalingpathway
AT yiye theadenosinea2breceptorpromotestumorprogressionofbladderurothelialcarcinomabyenhancingmapksignalingpathway
AT liujianye theadenosinea2breceptorpromotestumorprogressionofbladderurothelialcarcinomabyenhancingmapksignalingpathway
AT tangjin theadenosinea2breceptorpromotestumorprogressionofbladderurothelialcarcinomabyenhancingmapksignalingpathway
AT tangyuxin theadenosinea2breceptorpromotestumorprogressionofbladderurothelialcarcinomabyenhancingmapksignalingpathway
AT xiayang theadenosinea2breceptorpromotestumorprogressionofbladderurothelialcarcinomabyenhancingmapksignalingpathway
AT daiyingbo theadenosinea2breceptorpromotestumorprogressionofbladderurothelialcarcinomabyenhancingmapksignalingpathway
AT zhouyihong adenosinea2breceptorpromotestumorprogressionofbladderurothelialcarcinomabyenhancingmapksignalingpathway
AT chuxi adenosinea2breceptorpromotestumorprogressionofbladderurothelialcarcinomabyenhancingmapksignalingpathway
AT dengfei adenosinea2breceptorpromotestumorprogressionofbladderurothelialcarcinomabyenhancingmapksignalingpathway
AT tongliang adenosinea2breceptorpromotestumorprogressionofbladderurothelialcarcinomabyenhancingmapksignalingpathway
AT tongguoxiong adenosinea2breceptorpromotestumorprogressionofbladderurothelialcarcinomabyenhancingmapksignalingpathway
AT yiye adenosinea2breceptorpromotestumorprogressionofbladderurothelialcarcinomabyenhancingmapksignalingpathway
AT liujianye adenosinea2breceptorpromotestumorprogressionofbladderurothelialcarcinomabyenhancingmapksignalingpathway
AT tangjin adenosinea2breceptorpromotestumorprogressionofbladderurothelialcarcinomabyenhancingmapksignalingpathway
AT tangyuxin adenosinea2breceptorpromotestumorprogressionofbladderurothelialcarcinomabyenhancingmapksignalingpathway
AT xiayang adenosinea2breceptorpromotestumorprogressionofbladderurothelialcarcinomabyenhancingmapksignalingpathway
AT daiyingbo adenosinea2breceptorpromotestumorprogressionofbladderurothelialcarcinomabyenhancingmapksignalingpathway