Cargando…
A homozygous missense variant in HSD17B4 identified in a consanguineous Chinese Han family with type II Perrault syndrome
BACKGROUND: Perrault syndrome is a rare multisystem disorder that manifests with sensorineural hearing loss in both sexes, primary ovarian insufficiency in females and neurological features. The syndrome is heterogeneous both genetically and phenotypically. CASE PRESENTATION: We reported a consangui...
Autores principales: | , , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2017
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5568266/ https://www.ncbi.nlm.nih.gov/pubmed/28830375 http://dx.doi.org/10.1186/s12881-017-0453-0 |
_version_ | 1783258824746991616 |
---|---|
author | Chen, Kui Yang, Ke Luo, Su-Shan Chen, Chen Wang, Ying Wang, Yi-Xuan Li, Da-Ke Yang, Yu-Jie Tang, Yi-Lin Liu, Feng-Tao Wang, Jian Wu, Jian-Jun Sun, Yi-Min |
author_facet | Chen, Kui Yang, Ke Luo, Su-Shan Chen, Chen Wang, Ying Wang, Yi-Xuan Li, Da-Ke Yang, Yu-Jie Tang, Yi-Lin Liu, Feng-Tao Wang, Jian Wu, Jian-Jun Sun, Yi-Min |
author_sort | Chen, Kui |
collection | PubMed |
description | BACKGROUND: Perrault syndrome is a rare multisystem disorder that manifests with sensorineural hearing loss in both sexes, primary ovarian insufficiency in females and neurological features. The syndrome is heterogeneous both genetically and phenotypically. CASE PRESENTATION: We reported a consanguineous family (two affected sisters) with Perrault syndrome. The proband had the characteristics of Perrault syndrome: ovarian dysgenesis, bilateral hearing loss and obvious neurological signs. Target genetic sequencing and triplet repeat primed PCR (TP-PCR) plus capillary electrophoresis was conducted to detect causative mutations in the proband. The detected variant was further confirmed in the proband and tested in other family members by Sanger sequencing. Both the proband and her sister were found homozygous for the novel variant HSD17B4 c.298G > T (p.A100S) with their parents heterozygous. Detected by western blot, the protein expression of HSD17B4 mutant was much lower than that of the wild type in SH-SY5Y cells transfected by HSD17B4 wild type or mutant plasmid, which indicated the pathogenicity of the HSD17B4 mutation. CONCLUSIONS: Our findings supported that HSD17B4 was one of the genes contributing to Perrault syndrome with the likely pathogenic variant c.298G > T (p.A100S). Special manifestations of cerebellar impairment were found in cases caused by HSD17B4 mutations. Besides, attention should be paid to distinguish Perrault syndrome from D-bifunctional protein deficiency and hereditary ataxia. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s12881-017-0453-0) contains supplementary material, which is available to authorized users. |
format | Online Article Text |
id | pubmed-5568266 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2017 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-55682662017-08-29 A homozygous missense variant in HSD17B4 identified in a consanguineous Chinese Han family with type II Perrault syndrome Chen, Kui Yang, Ke Luo, Su-Shan Chen, Chen Wang, Ying Wang, Yi-Xuan Li, Da-Ke Yang, Yu-Jie Tang, Yi-Lin Liu, Feng-Tao Wang, Jian Wu, Jian-Jun Sun, Yi-Min BMC Med Genet Case Report BACKGROUND: Perrault syndrome is a rare multisystem disorder that manifests with sensorineural hearing loss in both sexes, primary ovarian insufficiency in females and neurological features. The syndrome is heterogeneous both genetically and phenotypically. CASE PRESENTATION: We reported a consanguineous family (two affected sisters) with Perrault syndrome. The proband had the characteristics of Perrault syndrome: ovarian dysgenesis, bilateral hearing loss and obvious neurological signs. Target genetic sequencing and triplet repeat primed PCR (TP-PCR) plus capillary electrophoresis was conducted to detect causative mutations in the proband. The detected variant was further confirmed in the proband and tested in other family members by Sanger sequencing. Both the proband and her sister were found homozygous for the novel variant HSD17B4 c.298G > T (p.A100S) with their parents heterozygous. Detected by western blot, the protein expression of HSD17B4 mutant was much lower than that of the wild type in SH-SY5Y cells transfected by HSD17B4 wild type or mutant plasmid, which indicated the pathogenicity of the HSD17B4 mutation. CONCLUSIONS: Our findings supported that HSD17B4 was one of the genes contributing to Perrault syndrome with the likely pathogenic variant c.298G > T (p.A100S). Special manifestations of cerebellar impairment were found in cases caused by HSD17B4 mutations. Besides, attention should be paid to distinguish Perrault syndrome from D-bifunctional protein deficiency and hereditary ataxia. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s12881-017-0453-0) contains supplementary material, which is available to authorized users. BioMed Central 2017-08-23 /pmc/articles/PMC5568266/ /pubmed/28830375 http://dx.doi.org/10.1186/s12881-017-0453-0 Text en © The Author(s). 2017 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Case Report Chen, Kui Yang, Ke Luo, Su-Shan Chen, Chen Wang, Ying Wang, Yi-Xuan Li, Da-Ke Yang, Yu-Jie Tang, Yi-Lin Liu, Feng-Tao Wang, Jian Wu, Jian-Jun Sun, Yi-Min A homozygous missense variant in HSD17B4 identified in a consanguineous Chinese Han family with type II Perrault syndrome |
title | A homozygous missense variant in HSD17B4 identified in a consanguineous Chinese Han family with type II Perrault syndrome |
title_full | A homozygous missense variant in HSD17B4 identified in a consanguineous Chinese Han family with type II Perrault syndrome |
title_fullStr | A homozygous missense variant in HSD17B4 identified in a consanguineous Chinese Han family with type II Perrault syndrome |
title_full_unstemmed | A homozygous missense variant in HSD17B4 identified in a consanguineous Chinese Han family with type II Perrault syndrome |
title_short | A homozygous missense variant in HSD17B4 identified in a consanguineous Chinese Han family with type II Perrault syndrome |
title_sort | homozygous missense variant in hsd17b4 identified in a consanguineous chinese han family with type ii perrault syndrome |
topic | Case Report |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5568266/ https://www.ncbi.nlm.nih.gov/pubmed/28830375 http://dx.doi.org/10.1186/s12881-017-0453-0 |
work_keys_str_mv | AT chenkui ahomozygousmissensevariantinhsd17b4identifiedinaconsanguineouschinesehanfamilywithtypeiiperraultsyndrome AT yangke ahomozygousmissensevariantinhsd17b4identifiedinaconsanguineouschinesehanfamilywithtypeiiperraultsyndrome AT luosushan ahomozygousmissensevariantinhsd17b4identifiedinaconsanguineouschinesehanfamilywithtypeiiperraultsyndrome AT chenchen ahomozygousmissensevariantinhsd17b4identifiedinaconsanguineouschinesehanfamilywithtypeiiperraultsyndrome AT wangying ahomozygousmissensevariantinhsd17b4identifiedinaconsanguineouschinesehanfamilywithtypeiiperraultsyndrome AT wangyixuan ahomozygousmissensevariantinhsd17b4identifiedinaconsanguineouschinesehanfamilywithtypeiiperraultsyndrome AT lidake ahomozygousmissensevariantinhsd17b4identifiedinaconsanguineouschinesehanfamilywithtypeiiperraultsyndrome AT yangyujie ahomozygousmissensevariantinhsd17b4identifiedinaconsanguineouschinesehanfamilywithtypeiiperraultsyndrome AT tangyilin ahomozygousmissensevariantinhsd17b4identifiedinaconsanguineouschinesehanfamilywithtypeiiperraultsyndrome AT liufengtao ahomozygousmissensevariantinhsd17b4identifiedinaconsanguineouschinesehanfamilywithtypeiiperraultsyndrome AT wangjian ahomozygousmissensevariantinhsd17b4identifiedinaconsanguineouschinesehanfamilywithtypeiiperraultsyndrome AT wujianjun ahomozygousmissensevariantinhsd17b4identifiedinaconsanguineouschinesehanfamilywithtypeiiperraultsyndrome AT sunyimin ahomozygousmissensevariantinhsd17b4identifiedinaconsanguineouschinesehanfamilywithtypeiiperraultsyndrome AT chenkui homozygousmissensevariantinhsd17b4identifiedinaconsanguineouschinesehanfamilywithtypeiiperraultsyndrome AT yangke homozygousmissensevariantinhsd17b4identifiedinaconsanguineouschinesehanfamilywithtypeiiperraultsyndrome AT luosushan homozygousmissensevariantinhsd17b4identifiedinaconsanguineouschinesehanfamilywithtypeiiperraultsyndrome AT chenchen homozygousmissensevariantinhsd17b4identifiedinaconsanguineouschinesehanfamilywithtypeiiperraultsyndrome AT wangying homozygousmissensevariantinhsd17b4identifiedinaconsanguineouschinesehanfamilywithtypeiiperraultsyndrome AT wangyixuan homozygousmissensevariantinhsd17b4identifiedinaconsanguineouschinesehanfamilywithtypeiiperraultsyndrome AT lidake homozygousmissensevariantinhsd17b4identifiedinaconsanguineouschinesehanfamilywithtypeiiperraultsyndrome AT yangyujie homozygousmissensevariantinhsd17b4identifiedinaconsanguineouschinesehanfamilywithtypeiiperraultsyndrome AT tangyilin homozygousmissensevariantinhsd17b4identifiedinaconsanguineouschinesehanfamilywithtypeiiperraultsyndrome AT liufengtao homozygousmissensevariantinhsd17b4identifiedinaconsanguineouschinesehanfamilywithtypeiiperraultsyndrome AT wangjian homozygousmissensevariantinhsd17b4identifiedinaconsanguineouschinesehanfamilywithtypeiiperraultsyndrome AT wujianjun homozygousmissensevariantinhsd17b4identifiedinaconsanguineouschinesehanfamilywithtypeiiperraultsyndrome AT sunyimin homozygousmissensevariantinhsd17b4identifiedinaconsanguineouschinesehanfamilywithtypeiiperraultsyndrome |