Cargando…

A homozygous missense variant in HSD17B4 identified in a consanguineous Chinese Han family with type II Perrault syndrome

BACKGROUND: Perrault syndrome is a rare multisystem disorder that manifests with sensorineural hearing loss in both sexes, primary ovarian insufficiency in females and neurological features. The syndrome is heterogeneous both genetically and phenotypically. CASE PRESENTATION: We reported a consangui...

Descripción completa

Detalles Bibliográficos
Autores principales: Chen, Kui, Yang, Ke, Luo, Su-Shan, Chen, Chen, Wang, Ying, Wang, Yi-Xuan, Li, Da-Ke, Yang, Yu-Jie, Tang, Yi-Lin, Liu, Feng-Tao, Wang, Jian, Wu, Jian-Jun, Sun, Yi-Min
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2017
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5568266/
https://www.ncbi.nlm.nih.gov/pubmed/28830375
http://dx.doi.org/10.1186/s12881-017-0453-0
_version_ 1783258824746991616
author Chen, Kui
Yang, Ke
Luo, Su-Shan
Chen, Chen
Wang, Ying
Wang, Yi-Xuan
Li, Da-Ke
Yang, Yu-Jie
Tang, Yi-Lin
Liu, Feng-Tao
Wang, Jian
Wu, Jian-Jun
Sun, Yi-Min
author_facet Chen, Kui
Yang, Ke
Luo, Su-Shan
Chen, Chen
Wang, Ying
Wang, Yi-Xuan
Li, Da-Ke
Yang, Yu-Jie
Tang, Yi-Lin
Liu, Feng-Tao
Wang, Jian
Wu, Jian-Jun
Sun, Yi-Min
author_sort Chen, Kui
collection PubMed
description BACKGROUND: Perrault syndrome is a rare multisystem disorder that manifests with sensorineural hearing loss in both sexes, primary ovarian insufficiency in females and neurological features. The syndrome is heterogeneous both genetically and phenotypically. CASE PRESENTATION: We reported a consanguineous family (two affected sisters) with Perrault syndrome. The proband had the characteristics of Perrault syndrome: ovarian dysgenesis, bilateral hearing loss and obvious neurological signs. Target genetic sequencing and triplet repeat primed PCR (TP-PCR) plus capillary electrophoresis was conducted to detect causative mutations in the proband. The detected variant was further confirmed in the proband and tested in other family members by Sanger sequencing. Both the proband and her sister were found homozygous for the novel variant HSD17B4 c.298G > T (p.A100S) with their parents heterozygous. Detected by western blot, the protein expression of HSD17B4 mutant was much lower than that of the wild type in SH-SY5Y cells transfected by HSD17B4 wild type or mutant plasmid, which indicated the pathogenicity of the HSD17B4 mutation. CONCLUSIONS: Our findings supported that HSD17B4 was one of the genes contributing to Perrault syndrome with the likely pathogenic variant c.298G > T (p.A100S). Special manifestations of cerebellar impairment were found in cases caused by HSD17B4 mutations. Besides, attention should be paid to distinguish Perrault syndrome from D-bifunctional protein deficiency and hereditary ataxia. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s12881-017-0453-0) contains supplementary material, which is available to authorized users.
format Online
Article
Text
id pubmed-5568266
institution National Center for Biotechnology Information
language English
publishDate 2017
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-55682662017-08-29 A homozygous missense variant in HSD17B4 identified in a consanguineous Chinese Han family with type II Perrault syndrome Chen, Kui Yang, Ke Luo, Su-Shan Chen, Chen Wang, Ying Wang, Yi-Xuan Li, Da-Ke Yang, Yu-Jie Tang, Yi-Lin Liu, Feng-Tao Wang, Jian Wu, Jian-Jun Sun, Yi-Min BMC Med Genet Case Report BACKGROUND: Perrault syndrome is a rare multisystem disorder that manifests with sensorineural hearing loss in both sexes, primary ovarian insufficiency in females and neurological features. The syndrome is heterogeneous both genetically and phenotypically. CASE PRESENTATION: We reported a consanguineous family (two affected sisters) with Perrault syndrome. The proband had the characteristics of Perrault syndrome: ovarian dysgenesis, bilateral hearing loss and obvious neurological signs. Target genetic sequencing and triplet repeat primed PCR (TP-PCR) plus capillary electrophoresis was conducted to detect causative mutations in the proband. The detected variant was further confirmed in the proband and tested in other family members by Sanger sequencing. Both the proband and her sister were found homozygous for the novel variant HSD17B4 c.298G > T (p.A100S) with their parents heterozygous. Detected by western blot, the protein expression of HSD17B4 mutant was much lower than that of the wild type in SH-SY5Y cells transfected by HSD17B4 wild type or mutant plasmid, which indicated the pathogenicity of the HSD17B4 mutation. CONCLUSIONS: Our findings supported that HSD17B4 was one of the genes contributing to Perrault syndrome with the likely pathogenic variant c.298G > T (p.A100S). Special manifestations of cerebellar impairment were found in cases caused by HSD17B4 mutations. Besides, attention should be paid to distinguish Perrault syndrome from D-bifunctional protein deficiency and hereditary ataxia. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s12881-017-0453-0) contains supplementary material, which is available to authorized users. BioMed Central 2017-08-23 /pmc/articles/PMC5568266/ /pubmed/28830375 http://dx.doi.org/10.1186/s12881-017-0453-0 Text en © The Author(s). 2017 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Case Report
Chen, Kui
Yang, Ke
Luo, Su-Shan
Chen, Chen
Wang, Ying
Wang, Yi-Xuan
Li, Da-Ke
Yang, Yu-Jie
Tang, Yi-Lin
Liu, Feng-Tao
Wang, Jian
Wu, Jian-Jun
Sun, Yi-Min
A homozygous missense variant in HSD17B4 identified in a consanguineous Chinese Han family with type II Perrault syndrome
title A homozygous missense variant in HSD17B4 identified in a consanguineous Chinese Han family with type II Perrault syndrome
title_full A homozygous missense variant in HSD17B4 identified in a consanguineous Chinese Han family with type II Perrault syndrome
title_fullStr A homozygous missense variant in HSD17B4 identified in a consanguineous Chinese Han family with type II Perrault syndrome
title_full_unstemmed A homozygous missense variant in HSD17B4 identified in a consanguineous Chinese Han family with type II Perrault syndrome
title_short A homozygous missense variant in HSD17B4 identified in a consanguineous Chinese Han family with type II Perrault syndrome
title_sort homozygous missense variant in hsd17b4 identified in a consanguineous chinese han family with type ii perrault syndrome
topic Case Report
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5568266/
https://www.ncbi.nlm.nih.gov/pubmed/28830375
http://dx.doi.org/10.1186/s12881-017-0453-0
work_keys_str_mv AT chenkui ahomozygousmissensevariantinhsd17b4identifiedinaconsanguineouschinesehanfamilywithtypeiiperraultsyndrome
AT yangke ahomozygousmissensevariantinhsd17b4identifiedinaconsanguineouschinesehanfamilywithtypeiiperraultsyndrome
AT luosushan ahomozygousmissensevariantinhsd17b4identifiedinaconsanguineouschinesehanfamilywithtypeiiperraultsyndrome
AT chenchen ahomozygousmissensevariantinhsd17b4identifiedinaconsanguineouschinesehanfamilywithtypeiiperraultsyndrome
AT wangying ahomozygousmissensevariantinhsd17b4identifiedinaconsanguineouschinesehanfamilywithtypeiiperraultsyndrome
AT wangyixuan ahomozygousmissensevariantinhsd17b4identifiedinaconsanguineouschinesehanfamilywithtypeiiperraultsyndrome
AT lidake ahomozygousmissensevariantinhsd17b4identifiedinaconsanguineouschinesehanfamilywithtypeiiperraultsyndrome
AT yangyujie ahomozygousmissensevariantinhsd17b4identifiedinaconsanguineouschinesehanfamilywithtypeiiperraultsyndrome
AT tangyilin ahomozygousmissensevariantinhsd17b4identifiedinaconsanguineouschinesehanfamilywithtypeiiperraultsyndrome
AT liufengtao ahomozygousmissensevariantinhsd17b4identifiedinaconsanguineouschinesehanfamilywithtypeiiperraultsyndrome
AT wangjian ahomozygousmissensevariantinhsd17b4identifiedinaconsanguineouschinesehanfamilywithtypeiiperraultsyndrome
AT wujianjun ahomozygousmissensevariantinhsd17b4identifiedinaconsanguineouschinesehanfamilywithtypeiiperraultsyndrome
AT sunyimin ahomozygousmissensevariantinhsd17b4identifiedinaconsanguineouschinesehanfamilywithtypeiiperraultsyndrome
AT chenkui homozygousmissensevariantinhsd17b4identifiedinaconsanguineouschinesehanfamilywithtypeiiperraultsyndrome
AT yangke homozygousmissensevariantinhsd17b4identifiedinaconsanguineouschinesehanfamilywithtypeiiperraultsyndrome
AT luosushan homozygousmissensevariantinhsd17b4identifiedinaconsanguineouschinesehanfamilywithtypeiiperraultsyndrome
AT chenchen homozygousmissensevariantinhsd17b4identifiedinaconsanguineouschinesehanfamilywithtypeiiperraultsyndrome
AT wangying homozygousmissensevariantinhsd17b4identifiedinaconsanguineouschinesehanfamilywithtypeiiperraultsyndrome
AT wangyixuan homozygousmissensevariantinhsd17b4identifiedinaconsanguineouschinesehanfamilywithtypeiiperraultsyndrome
AT lidake homozygousmissensevariantinhsd17b4identifiedinaconsanguineouschinesehanfamilywithtypeiiperraultsyndrome
AT yangyujie homozygousmissensevariantinhsd17b4identifiedinaconsanguineouschinesehanfamilywithtypeiiperraultsyndrome
AT tangyilin homozygousmissensevariantinhsd17b4identifiedinaconsanguineouschinesehanfamilywithtypeiiperraultsyndrome
AT liufengtao homozygousmissensevariantinhsd17b4identifiedinaconsanguineouschinesehanfamilywithtypeiiperraultsyndrome
AT wangjian homozygousmissensevariantinhsd17b4identifiedinaconsanguineouschinesehanfamilywithtypeiiperraultsyndrome
AT wujianjun homozygousmissensevariantinhsd17b4identifiedinaconsanguineouschinesehanfamilywithtypeiiperraultsyndrome
AT sunyimin homozygousmissensevariantinhsd17b4identifiedinaconsanguineouschinesehanfamilywithtypeiiperraultsyndrome