Cargando…

Variability and population genetic structure in Achyrocline flaccida (Weinm.) DC., a species with high value in folk medicine in South America

Better knowledge of medicinal plant species and their conservation is an urgent need worldwide. Decision making for conservation strategies can be based on the knowledge of the variability and population genetic structure of the species and on the events that may influence these genetic parameters....

Descripción completa

Detalles Bibliográficos
Autores principales: da Rosa, Juliana, Weber, Gabriela Gomes, Cardoso, Rafaela, Górski, Felipe, Da-Silva, Paulo Roberto
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Public Library of Science 2017
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5568751/
https://www.ncbi.nlm.nih.gov/pubmed/28829814
http://dx.doi.org/10.1371/journal.pone.0183533
_version_ 1783258889830006784
author da Rosa, Juliana
Weber, Gabriela Gomes
Cardoso, Rafaela
Górski, Felipe
Da-Silva, Paulo Roberto
author_facet da Rosa, Juliana
Weber, Gabriela Gomes
Cardoso, Rafaela
Górski, Felipe
Da-Silva, Paulo Roberto
author_sort da Rosa, Juliana
collection PubMed
description Better knowledge of medicinal plant species and their conservation is an urgent need worldwide. Decision making for conservation strategies can be based on the knowledge of the variability and population genetic structure of the species and on the events that may influence these genetic parameters. Achyrocline flaccida (Weinm.) DC. is a native plant from the grassy fields of South America with high value in folk medicine. In spite of its importance, no genetic and conservation studies are available for the species. In this work, microsatellite and ISSR (inter-simple sequence repeat) markers were used to estimate the genetic variability and structure of seven populations of A. flaccida from southern Brazil. The microsatellite markers were inefficient in A. flaccida owing to a high number of null alleles. After the evaluation of 42 ISSR primers on one population, 10 were selected for further analysis of seven A. flaccida populations. The results of ISSR showed that the high number of exclusive absence of loci might contribute to the inter-population differentiation. Genetic variability of the species was high (Nei’s diversity of 0.23 and Shannon diversity of 0.37). AMOVA indicated higher genetic variability within (64.7%) than among (33.96%) populations, and the variability was unevenly distributed (F(ST) 0.33). Gene flow among populations ranged from 1.68 to 5.2 migrants per generation, with an average of 1.39. The results of PCoA and Bayesian analyses corroborated and indicated that the populations are structured. The observed genetic variability and population structure of A. flaccida are discussed in the context of the vegetation formation history in southern Brazil, as well as the possible anthropogenic effects. Additionally, we discuss the implications of the results in the conservation of the species.
format Online
Article
Text
id pubmed-5568751
institution National Center for Biotechnology Information
language English
publishDate 2017
publisher Public Library of Science
record_format MEDLINE/PubMed
spelling pubmed-55687512017-09-09 Variability and population genetic structure in Achyrocline flaccida (Weinm.) DC., a species with high value in folk medicine in South America da Rosa, Juliana Weber, Gabriela Gomes Cardoso, Rafaela Górski, Felipe Da-Silva, Paulo Roberto PLoS One Research Article Better knowledge of medicinal plant species and their conservation is an urgent need worldwide. Decision making for conservation strategies can be based on the knowledge of the variability and population genetic structure of the species and on the events that may influence these genetic parameters. Achyrocline flaccida (Weinm.) DC. is a native plant from the grassy fields of South America with high value in folk medicine. In spite of its importance, no genetic and conservation studies are available for the species. In this work, microsatellite and ISSR (inter-simple sequence repeat) markers were used to estimate the genetic variability and structure of seven populations of A. flaccida from southern Brazil. The microsatellite markers were inefficient in A. flaccida owing to a high number of null alleles. After the evaluation of 42 ISSR primers on one population, 10 were selected for further analysis of seven A. flaccida populations. The results of ISSR showed that the high number of exclusive absence of loci might contribute to the inter-population differentiation. Genetic variability of the species was high (Nei’s diversity of 0.23 and Shannon diversity of 0.37). AMOVA indicated higher genetic variability within (64.7%) than among (33.96%) populations, and the variability was unevenly distributed (F(ST) 0.33). Gene flow among populations ranged from 1.68 to 5.2 migrants per generation, with an average of 1.39. The results of PCoA and Bayesian analyses corroborated and indicated that the populations are structured. The observed genetic variability and population structure of A. flaccida are discussed in the context of the vegetation formation history in southern Brazil, as well as the possible anthropogenic effects. Additionally, we discuss the implications of the results in the conservation of the species. Public Library of Science 2017-08-22 /pmc/articles/PMC5568751/ /pubmed/28829814 http://dx.doi.org/10.1371/journal.pone.0183533 Text en © 2017 Rosa et al http://creativecommons.org/licenses/by/4.0/ This is an open access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/) , which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited.
spellingShingle Research Article
da Rosa, Juliana
Weber, Gabriela Gomes
Cardoso, Rafaela
Górski, Felipe
Da-Silva, Paulo Roberto
Variability and population genetic structure in Achyrocline flaccida (Weinm.) DC., a species with high value in folk medicine in South America
title Variability and population genetic structure in Achyrocline flaccida (Weinm.) DC., a species with high value in folk medicine in South America
title_full Variability and population genetic structure in Achyrocline flaccida (Weinm.) DC., a species with high value in folk medicine in South America
title_fullStr Variability and population genetic structure in Achyrocline flaccida (Weinm.) DC., a species with high value in folk medicine in South America
title_full_unstemmed Variability and population genetic structure in Achyrocline flaccida (Weinm.) DC., a species with high value in folk medicine in South America
title_short Variability and population genetic structure in Achyrocline flaccida (Weinm.) DC., a species with high value in folk medicine in South America
title_sort variability and population genetic structure in achyrocline flaccida (weinm.) dc., a species with high value in folk medicine in south america
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5568751/
https://www.ncbi.nlm.nih.gov/pubmed/28829814
http://dx.doi.org/10.1371/journal.pone.0183533
work_keys_str_mv AT darosajuliana variabilityandpopulationgeneticstructureinachyroclineflaccidaweinmdcaspecieswithhighvalueinfolkmedicineinsouthamerica
AT webergabrielagomes variabilityandpopulationgeneticstructureinachyroclineflaccidaweinmdcaspecieswithhighvalueinfolkmedicineinsouthamerica
AT cardosorafaela variabilityandpopulationgeneticstructureinachyroclineflaccidaweinmdcaspecieswithhighvalueinfolkmedicineinsouthamerica
AT gorskifelipe variabilityandpopulationgeneticstructureinachyroclineflaccidaweinmdcaspecieswithhighvalueinfolkmedicineinsouthamerica
AT dasilvapauloroberto variabilityandpopulationgeneticstructureinachyroclineflaccidaweinmdcaspecieswithhighvalueinfolkmedicineinsouthamerica