Cargando…
Does Value Stream Mapping affect the structure, process, and outcome quality in care facilities? A systematic review
BACKGROUND: Quality improvement within health and social care facilities is needed and has to be evidence-based and patient-centered. Value Stream Mapping, a method of Lean management, aims to increase the patients’ value and quality of care by a visualization and quantification of the care process....
Autores principales: | , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2017
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5571664/ https://www.ncbi.nlm.nih.gov/pubmed/28838320 http://dx.doi.org/10.1186/s13643-017-0563-y |
_version_ | 1783259387777777664 |
---|---|
author | Nowak, Marina Pfaff, Holger Karbach, Ute |
author_facet | Nowak, Marina Pfaff, Holger Karbach, Ute |
author_sort | Nowak, Marina |
collection | PubMed |
description | BACKGROUND: Quality improvement within health and social care facilities is needed and has to be evidence-based and patient-centered. Value Stream Mapping, a method of Lean management, aims to increase the patients’ value and quality of care by a visualization and quantification of the care process. The aim of this research is to examine the effectiveness of Value Stream Mapping on structure, process, and outcome quality in care facilities. METHODS: A systematic review is conducted. PubMed, EBSCOhost, including Business Source Complete, Academic Search Complete, PSYCInfo, PSYNDX, SocINDEX with Full Text, Web of Knowledge, and EMBASE ScienceDirect are searched in February 2016. All peer-reviewed papers evaluating Value Stream Mapping and published in English or German from January 2000 are included. For data synthesis, all study results are categorized into Donabedian’s model of structure, process, and outcome quality. To assess and interpret the effectiveness of Value Stream Mapping, the frequencies of the results statistically examined are considered. RESULTS: Of the 903 articles retrieved, 22 studies fulfill the inclusion criteria. Of these, 11 studies are used to answer the research question. Value Stream Mapping has positive effects on the time dimension of process and outcome quality. It seems to reduce non-value-added time (e.g., waiting time) and length of stay. All study designs are before and after studies without control, and methodologically sophisticated studies are missing. CONCLUSIONS: For a final conclusion about Value Stream Mapping’s effectiveness, more research with improved methodology is needed. Despite this lack of evidence, Value Stream Mapping has the potential to improve quality of care on the time dimension. The contextual influence has to be investigated to make conclusions about the relationship between different quality domains when applying Value Stream Mapping. However, for using this review’s conclusion, the limitation of including heterogeneous and potentially biased results has to be considered. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s13643-017-0563-y) contains supplementary material, which is available to authorized users. |
format | Online Article Text |
id | pubmed-5571664 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2017 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-55716642017-08-30 Does Value Stream Mapping affect the structure, process, and outcome quality in care facilities? A systematic review Nowak, Marina Pfaff, Holger Karbach, Ute Syst Rev Research BACKGROUND: Quality improvement within health and social care facilities is needed and has to be evidence-based and patient-centered. Value Stream Mapping, a method of Lean management, aims to increase the patients’ value and quality of care by a visualization and quantification of the care process. The aim of this research is to examine the effectiveness of Value Stream Mapping on structure, process, and outcome quality in care facilities. METHODS: A systematic review is conducted. PubMed, EBSCOhost, including Business Source Complete, Academic Search Complete, PSYCInfo, PSYNDX, SocINDEX with Full Text, Web of Knowledge, and EMBASE ScienceDirect are searched in February 2016. All peer-reviewed papers evaluating Value Stream Mapping and published in English or German from January 2000 are included. For data synthesis, all study results are categorized into Donabedian’s model of structure, process, and outcome quality. To assess and interpret the effectiveness of Value Stream Mapping, the frequencies of the results statistically examined are considered. RESULTS: Of the 903 articles retrieved, 22 studies fulfill the inclusion criteria. Of these, 11 studies are used to answer the research question. Value Stream Mapping has positive effects on the time dimension of process and outcome quality. It seems to reduce non-value-added time (e.g., waiting time) and length of stay. All study designs are before and after studies without control, and methodologically sophisticated studies are missing. CONCLUSIONS: For a final conclusion about Value Stream Mapping’s effectiveness, more research with improved methodology is needed. Despite this lack of evidence, Value Stream Mapping has the potential to improve quality of care on the time dimension. The contextual influence has to be investigated to make conclusions about the relationship between different quality domains when applying Value Stream Mapping. However, for using this review’s conclusion, the limitation of including heterogeneous and potentially biased results has to be considered. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s13643-017-0563-y) contains supplementary material, which is available to authorized users. BioMed Central 2017-08-24 /pmc/articles/PMC5571664/ /pubmed/28838320 http://dx.doi.org/10.1186/s13643-017-0563-y Text en © The Author(s). 2017 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Nowak, Marina Pfaff, Holger Karbach, Ute Does Value Stream Mapping affect the structure, process, and outcome quality in care facilities? A systematic review |
title | Does Value Stream Mapping affect the structure, process, and outcome quality in care facilities? A systematic review |
title_full | Does Value Stream Mapping affect the structure, process, and outcome quality in care facilities? A systematic review |
title_fullStr | Does Value Stream Mapping affect the structure, process, and outcome quality in care facilities? A systematic review |
title_full_unstemmed | Does Value Stream Mapping affect the structure, process, and outcome quality in care facilities? A systematic review |
title_short | Does Value Stream Mapping affect the structure, process, and outcome quality in care facilities? A systematic review |
title_sort | does value stream mapping affect the structure, process, and outcome quality in care facilities? a systematic review |
topic | Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5571664/ https://www.ncbi.nlm.nih.gov/pubmed/28838320 http://dx.doi.org/10.1186/s13643-017-0563-y |
work_keys_str_mv | AT nowakmarina doesvaluestreammappingaffectthestructureprocessandoutcomequalityincarefacilitiesasystematicreview AT pfaffholger doesvaluestreammappingaffectthestructureprocessandoutcomequalityincarefacilitiesasystematicreview AT karbachute doesvaluestreammappingaffectthestructureprocessandoutcomequalityincarefacilitiesasystematicreview |