Cargando…
Protective Role of Mast Cells in Primary Systemic Vasculitis: A Perspective
Mast cells are important cells of the immune system. Although traditionally considered as key players in allergic and hypersensitivity reactions, emerging evidence suggests that mast cells have many complex roles in vascular disease. These include regulation of vasodilation, angiogenesis, activation...
Autores principales: | , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Frontiers Media S.A.
2017
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5572344/ https://www.ncbi.nlm.nih.gov/pubmed/28878769 http://dx.doi.org/10.3389/fimmu.2017.00990 |
_version_ | 1783259507709706240 |
---|---|
author | Springer, Jason M. Raveendran, Vineesh V. Gierer, Selina A. Maz, Mehrdad Dileepan, Kottarappat N. |
author_facet | Springer, Jason M. Raveendran, Vineesh V. Gierer, Selina A. Maz, Mehrdad Dileepan, Kottarappat N. |
author_sort | Springer, Jason M. |
collection | PubMed |
description | Mast cells are important cells of the immune system. Although traditionally considered as key players in allergic and hypersensitivity reactions, emerging evidence suggests that mast cells have many complex roles in vascular disease. These include regulation of vasodilation, angiogenesis, activation of matrix metalloproteinases, apoptosis of smooth muscle cells, and activation of the renin angiotensin system. Mast cells are also known to play an immunomodulatory role via modulation of regulatory T-cell (Treg), macrophage and endothelial cell functions. This dual role of the mast cells is evident in myeloperoxidase anti-neutrophil cytoplasmic antibodies-mouse model of glomerulonephritis in which mast cell deficiency worsens glomerulonephritis, whereas inhibition of mast cell degranulation is effective in abrogating the development of glomerulonephritis. Our previous work demonstrated that mast cell degranulation inhibits lipopolysaccharide-induced interleukin 6 (IL-6) production in mice. This effect was not seen in histamine-1-receptor knockout (H1R(−/−)) mice suggesting a role for histamine in IL-6 homeostasis. In addition, mast cell degranulation-mediated decrease in IL-6 production was associated with an upregulation of suppressor of cytokine signaling-1 protein in the aorta. We propose that mast cells regulate large artery inflammation through T-cells, shifting a primarily Th1 and Th17 toward a Th2 response and leading to enhanced IL-10 production, activation Treg cells, and the inhibition of macrophage functions. |
format | Online Article Text |
id | pubmed-5572344 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2017 |
publisher | Frontiers Media S.A. |
record_format | MEDLINE/PubMed |
spelling | pubmed-55723442017-09-06 Protective Role of Mast Cells in Primary Systemic Vasculitis: A Perspective Springer, Jason M. Raveendran, Vineesh V. Gierer, Selina A. Maz, Mehrdad Dileepan, Kottarappat N. Front Immunol Immunology Mast cells are important cells of the immune system. Although traditionally considered as key players in allergic and hypersensitivity reactions, emerging evidence suggests that mast cells have many complex roles in vascular disease. These include regulation of vasodilation, angiogenesis, activation of matrix metalloproteinases, apoptosis of smooth muscle cells, and activation of the renin angiotensin system. Mast cells are also known to play an immunomodulatory role via modulation of regulatory T-cell (Treg), macrophage and endothelial cell functions. This dual role of the mast cells is evident in myeloperoxidase anti-neutrophil cytoplasmic antibodies-mouse model of glomerulonephritis in which mast cell deficiency worsens glomerulonephritis, whereas inhibition of mast cell degranulation is effective in abrogating the development of glomerulonephritis. Our previous work demonstrated that mast cell degranulation inhibits lipopolysaccharide-induced interleukin 6 (IL-6) production in mice. This effect was not seen in histamine-1-receptor knockout (H1R(−/−)) mice suggesting a role for histamine in IL-6 homeostasis. In addition, mast cell degranulation-mediated decrease in IL-6 production was associated with an upregulation of suppressor of cytokine signaling-1 protein in the aorta. We propose that mast cells regulate large artery inflammation through T-cells, shifting a primarily Th1 and Th17 toward a Th2 response and leading to enhanced IL-10 production, activation Treg cells, and the inhibition of macrophage functions. Frontiers Media S.A. 2017-08-23 /pmc/articles/PMC5572344/ /pubmed/28878769 http://dx.doi.org/10.3389/fimmu.2017.00990 Text en Copyright © 2017 Springer, Raveendran, Gierer, Maz and Dileepan. http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) or licensor are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms. |
spellingShingle | Immunology Springer, Jason M. Raveendran, Vineesh V. Gierer, Selina A. Maz, Mehrdad Dileepan, Kottarappat N. Protective Role of Mast Cells in Primary Systemic Vasculitis: A Perspective |
title | Protective Role of Mast Cells in Primary Systemic Vasculitis: A Perspective |
title_full | Protective Role of Mast Cells in Primary Systemic Vasculitis: A Perspective |
title_fullStr | Protective Role of Mast Cells in Primary Systemic Vasculitis: A Perspective |
title_full_unstemmed | Protective Role of Mast Cells in Primary Systemic Vasculitis: A Perspective |
title_short | Protective Role of Mast Cells in Primary Systemic Vasculitis: A Perspective |
title_sort | protective role of mast cells in primary systemic vasculitis: a perspective |
topic | Immunology |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5572344/ https://www.ncbi.nlm.nih.gov/pubmed/28878769 http://dx.doi.org/10.3389/fimmu.2017.00990 |
work_keys_str_mv | AT springerjasonm protectiveroleofmastcellsinprimarysystemicvasculitisaperspective AT raveendranvineeshv protectiveroleofmastcellsinprimarysystemicvasculitisaperspective AT giererselinaa protectiveroleofmastcellsinprimarysystemicvasculitisaperspective AT mazmehrdad protectiveroleofmastcellsinprimarysystemicvasculitisaperspective AT dileepankottarappatn protectiveroleofmastcellsinprimarysystemicvasculitisaperspective |