Cargando…
Identification and Analysis of Mitogen-Activated Protein Kinase (MAPK) Cascades in Fragaria vesca
Mitogen-activated protein kinase (MAPK) cascades are highly conserved signaling modules in eukaryotes, including yeasts, plants and animals. MAPK cascades are responsible for protein phosphorylation during signal transduction events, and typically consist of three protein kinases: MAPK, MAPK kinase,...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2017
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5578155/ https://www.ncbi.nlm.nih.gov/pubmed/28805715 http://dx.doi.org/10.3390/ijms18081766 |
_version_ | 1783260482095808512 |
---|---|
author | Zhou, Heying Ren, Suyue Han, Yuanfang Zhang, Qing Qin, Ling Xing, Yu |
author_facet | Zhou, Heying Ren, Suyue Han, Yuanfang Zhang, Qing Qin, Ling Xing, Yu |
author_sort | Zhou, Heying |
collection | PubMed |
description | Mitogen-activated protein kinase (MAPK) cascades are highly conserved signaling modules in eukaryotes, including yeasts, plants and animals. MAPK cascades are responsible for protein phosphorylation during signal transduction events, and typically consist of three protein kinases: MAPK, MAPK kinase, and MAPK kinase kinase. In this current study, we identified a total of 12 FvMAPK, 7 FvMAPKK, 73 FvMAPKKK, and one FvMAPKKKK genes in the recently published Fragaria vesca genome sequence. This work reported the classification, annotation and phylogenetic evaluation of these genes and an assessment of conserved motifs and the expression profiling of members of the gene family were also analyzed here. The expression profiles of the MAPK and MAPKK genes in different organs and fruit developmental stages were further investigated using quantitative real-time reverse transcription PCR (qRT-PCR). Finally, the MAPK and MAPKK expression patterns in response to hormone and abiotic stresses (salt, drought, and high and low temperature) were investigated in fruit and leaves of F. vesca. The results provide a platform for further characterization of the physiological and biochemical functions of MAPK cascades in strawberry. |
format | Online Article Text |
id | pubmed-5578155 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2017 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-55781552017-09-05 Identification and Analysis of Mitogen-Activated Protein Kinase (MAPK) Cascades in Fragaria vesca Zhou, Heying Ren, Suyue Han, Yuanfang Zhang, Qing Qin, Ling Xing, Yu Int J Mol Sci Article Mitogen-activated protein kinase (MAPK) cascades are highly conserved signaling modules in eukaryotes, including yeasts, plants and animals. MAPK cascades are responsible for protein phosphorylation during signal transduction events, and typically consist of three protein kinases: MAPK, MAPK kinase, and MAPK kinase kinase. In this current study, we identified a total of 12 FvMAPK, 7 FvMAPKK, 73 FvMAPKKK, and one FvMAPKKKK genes in the recently published Fragaria vesca genome sequence. This work reported the classification, annotation and phylogenetic evaluation of these genes and an assessment of conserved motifs and the expression profiling of members of the gene family were also analyzed here. The expression profiles of the MAPK and MAPKK genes in different organs and fruit developmental stages were further investigated using quantitative real-time reverse transcription PCR (qRT-PCR). Finally, the MAPK and MAPKK expression patterns in response to hormone and abiotic stresses (salt, drought, and high and low temperature) were investigated in fruit and leaves of F. vesca. The results provide a platform for further characterization of the physiological and biochemical functions of MAPK cascades in strawberry. MDPI 2017-08-13 /pmc/articles/PMC5578155/ /pubmed/28805715 http://dx.doi.org/10.3390/ijms18081766 Text en © 2017 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/). |
spellingShingle | Article Zhou, Heying Ren, Suyue Han, Yuanfang Zhang, Qing Qin, Ling Xing, Yu Identification and Analysis of Mitogen-Activated Protein Kinase (MAPK) Cascades in Fragaria vesca |
title | Identification and Analysis of Mitogen-Activated Protein Kinase (MAPK) Cascades in Fragaria vesca |
title_full | Identification and Analysis of Mitogen-Activated Protein Kinase (MAPK) Cascades in Fragaria vesca |
title_fullStr | Identification and Analysis of Mitogen-Activated Protein Kinase (MAPK) Cascades in Fragaria vesca |
title_full_unstemmed | Identification and Analysis of Mitogen-Activated Protein Kinase (MAPK) Cascades in Fragaria vesca |
title_short | Identification and Analysis of Mitogen-Activated Protein Kinase (MAPK) Cascades in Fragaria vesca |
title_sort | identification and analysis of mitogen-activated protein kinase (mapk) cascades in fragaria vesca |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5578155/ https://www.ncbi.nlm.nih.gov/pubmed/28805715 http://dx.doi.org/10.3390/ijms18081766 |
work_keys_str_mv | AT zhouheying identificationandanalysisofmitogenactivatedproteinkinasemapkcascadesinfragariavesca AT rensuyue identificationandanalysisofmitogenactivatedproteinkinasemapkcascadesinfragariavesca AT hanyuanfang identificationandanalysisofmitogenactivatedproteinkinasemapkcascadesinfragariavesca AT zhangqing identificationandanalysisofmitogenactivatedproteinkinasemapkcascadesinfragariavesca AT qinling identificationandanalysisofmitogenactivatedproteinkinasemapkcascadesinfragariavesca AT xingyu identificationandanalysisofmitogenactivatedproteinkinasemapkcascadesinfragariavesca |