O’Connor et al. systematic review regarding animal feeding operations and public health: critical flaws may compromise conclusions

In this comment, we summarize several scientific concerns with the recently published systematic review from O’Connor and colleagues that examined the relationship between proximity to animal-feeding operations and health of individuals in nearby communities. The authors utilized a bias tool not des...

Descripción completa

Detalles Bibliográficos
Autores principales: Nachman, Keeve E., Lam, Juleen, Schinasi, Leah H., Smith, Tara C., Feingold, Beth J., Casey, Joan A.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2017
Materias:
Commentary
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5580209/
https://www.ncbi.nlm.nih.gov/pubmed/28859697
http://dx.doi.org/10.1186/s13643-017-0575-7
_version_ 1783260869439782912
author Nachman, Keeve E.
Lam, Juleen
Schinasi, Leah H.
Smith, Tara C.
Feingold, Beth J.
Casey, Joan A.
author_facet Nachman, Keeve E.
Lam, Juleen
Schinasi, Leah H.
Smith, Tara C.
Feingold, Beth J.
Casey, Joan A.
author_sort Nachman, Keeve E.
collection PubMed
description In this comment, we summarize several scientific concerns with the recently published systematic review from O’Connor and colleagues that examined the relationship between proximity to animal-feeding operations and health of individuals in nearby communities. The authors utilized a bias tool not designed for environmental health research, erroneously excluded important studies, and incorrectly interpreted others. As a result, the conclusions drawn in the review misrepresent the evidence from the published literature, limiting its value to policymakers, researchers, and the public.
format Online
Article
Text
id pubmed-5580209
institution National Center for Biotechnology Information
language English
publishDate 2017
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-55802092017-09-07 O’Connor et al. systematic review regarding animal feeding operations and public health: critical flaws may compromise conclusions Nachman, Keeve E. Lam, Juleen Schinasi, Leah H. Smith, Tara C. Feingold, Beth J. Casey, Joan A. Syst Rev Commentary In this comment, we summarize several scientific concerns with the recently published systematic review from O’Connor and colleagues that examined the relationship between proximity to animal-feeding operations and health of individuals in nearby communities. The authors utilized a bias tool not designed for environmental health research, erroneously excluded important studies, and incorrectly interpreted others. As a result, the conclusions drawn in the review misrepresent the evidence from the published literature, limiting its value to policymakers, researchers, and the public. BioMed Central 2017-08-31 /pmc/articles/PMC5580209/ /pubmed/28859697 http://dx.doi.org/10.1186/s13643-017-0575-7 Text en © The Author(s). 2017 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Commentary
Nachman, Keeve E.
Lam, Juleen
Schinasi, Leah H.
Smith, Tara C.
Feingold, Beth J.
Casey, Joan A.
O’Connor et al. systematic review regarding animal feeding operations and public health: critical flaws may compromise conclusions
title O’Connor et al. systematic review regarding animal feeding operations and public health: critical flaws may compromise conclusions
title_full O’Connor et al. systematic review regarding animal feeding operations and public health: critical flaws may compromise conclusions
title_fullStr O’Connor et al. systematic review regarding animal feeding operations and public health: critical flaws may compromise conclusions
title_full_unstemmed O’Connor et al. systematic review regarding animal feeding operations and public health: critical flaws may compromise conclusions
title_short O’Connor et al. systematic review regarding animal feeding operations and public health: critical flaws may compromise conclusions
title_sort o’connor et al. systematic review regarding animal feeding operations and public health: critical flaws may compromise conclusions
topic Commentary
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5580209/
https://www.ncbi.nlm.nih.gov/pubmed/28859697
http://dx.doi.org/10.1186/s13643-017-0575-7
work_keys_str_mv AT nachmankeevee oconnoretalsystematicreviewregardinganimalfeedingoperationsandpublichealthcriticalflawsmaycompromiseconclusions
AT lamjuleen oconnoretalsystematicreviewregardinganimalfeedingoperationsandpublichealthcriticalflawsmaycompromiseconclusions
AT schinasileahh oconnoretalsystematicreviewregardinganimalfeedingoperationsandpublichealthcriticalflawsmaycompromiseconclusions
AT smithtarac oconnoretalsystematicreviewregardinganimalfeedingoperationsandpublichealthcriticalflawsmaycompromiseconclusions
AT feingoldbethj oconnoretalsystematicreviewregardinganimalfeedingoperationsandpublichealthcriticalflawsmaycompromiseconclusions
AT caseyjoana oconnoretalsystematicreviewregardinganimalfeedingoperationsandpublichealthcriticalflawsmaycompromiseconclusions

Ejemplares similares