Cargando…

Versican G1 domain enhances adenoviral-mediated transgene expression and can be modulated by inhibitors of the Janus kinase (JAK)/STAT and Src family kinase pathways

To examine the biochemical influences that may contribute to the success of gene therapy for ocular disorders, the role of versican, a vitreous component, in adenoviral-mediated transgene expression was examined. Versican is a large chondroitin sulfate-containing, hyaluronic acid-binding proteoglyca...

Descripción completa

Detalles Bibliográficos
Autores principales: Akinfenwa, Patricia Y., Bond, Wesley S., Ildefonso, Cristhian J., Hurwitz, Mary Y., Hurwitz, Richard L.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: American Society for Biochemistry and Molecular Biology 2017
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5582833/
https://www.ncbi.nlm.nih.gov/pubmed/28684419
http://dx.doi.org/10.1074/jbc.M116.773549
_version_ 1783261250965209088
author Akinfenwa, Patricia Y.
Bond, Wesley S.
Ildefonso, Cristhian J.
Hurwitz, Mary Y.
Hurwitz, Richard L.
author_facet Akinfenwa, Patricia Y.
Bond, Wesley S.
Ildefonso, Cristhian J.
Hurwitz, Mary Y.
Hurwitz, Richard L.
author_sort Akinfenwa, Patricia Y.
collection PubMed
description To examine the biochemical influences that may contribute to the success of gene therapy for ocular disorders, the role of versican, a vitreous component, in adenoviral-mediated transgene expression was examined. Versican is a large chondroitin sulfate-containing, hyaluronic acid-binding proteoglycan present in the extracellular matrix and in ocular vitreous body. Y79 retinoblastoma cells and CD44-negative SK-N-DZ neuroblastoma cells transduced with adenoviral vectors in the presence of versican respond with an activation of transgene expression. Proteolysis of versican generates a hyaluronan-binding G1 domain. The addition of recombinant versican G1 to SK-N-DZ cells results in a similar activation of transgene expression, and treatment with dasatinib, an inhibitor of Src family kinases, also mimics the effects of versican. Enhancement is accompanied by an increase in signal transducer and activator of transcription 5 (STAT5) phosphorylation and is abrogated by treatment with C188-9, a STAT3/5 inhibitor, or with ruxolitinib, a Janus kinase 1/2 (JAK1/2) inhibitor. These data implicate versican G1 in enhancing adenoviral vector transgene expression in a hyaluronic acid-CD44 independent manner that is down-regulated by inhibitors of the JAK/STAT pathway and enhanced by inhibitors of the Src kinase pathway.
format Online
Article
Text
id pubmed-5582833
institution National Center for Biotechnology Information
language English
publishDate 2017
publisher American Society for Biochemistry and Molecular Biology
record_format MEDLINE/PubMed
spelling pubmed-55828332017-09-05 Versican G1 domain enhances adenoviral-mediated transgene expression and can be modulated by inhibitors of the Janus kinase (JAK)/STAT and Src family kinase pathways Akinfenwa, Patricia Y. Bond, Wesley S. Ildefonso, Cristhian J. Hurwitz, Mary Y. Hurwitz, Richard L. J Biol Chem Glycobiology and Extracellular Matrices To examine the biochemical influences that may contribute to the success of gene therapy for ocular disorders, the role of versican, a vitreous component, in adenoviral-mediated transgene expression was examined. Versican is a large chondroitin sulfate-containing, hyaluronic acid-binding proteoglycan present in the extracellular matrix and in ocular vitreous body. Y79 retinoblastoma cells and CD44-negative SK-N-DZ neuroblastoma cells transduced with adenoviral vectors in the presence of versican respond with an activation of transgene expression. Proteolysis of versican generates a hyaluronan-binding G1 domain. The addition of recombinant versican G1 to SK-N-DZ cells results in a similar activation of transgene expression, and treatment with dasatinib, an inhibitor of Src family kinases, also mimics the effects of versican. Enhancement is accompanied by an increase in signal transducer and activator of transcription 5 (STAT5) phosphorylation and is abrogated by treatment with C188-9, a STAT3/5 inhibitor, or with ruxolitinib, a Janus kinase 1/2 (JAK1/2) inhibitor. These data implicate versican G1 in enhancing adenoviral vector transgene expression in a hyaluronic acid-CD44 independent manner that is down-regulated by inhibitors of the JAK/STAT pathway and enhanced by inhibitors of the Src kinase pathway. American Society for Biochemistry and Molecular Biology 2017-09-01 2017-07-06 /pmc/articles/PMC5582833/ /pubmed/28684419 http://dx.doi.org/10.1074/jbc.M116.773549 Text en © 2017 by The American Society for Biochemistry and Molecular Biology, Inc. Author's Choice—Final version free via Creative Commons CC-BY license (http://creativecommons.org/licenses/by/4.0) .
spellingShingle Glycobiology and Extracellular Matrices
Akinfenwa, Patricia Y.
Bond, Wesley S.
Ildefonso, Cristhian J.
Hurwitz, Mary Y.
Hurwitz, Richard L.
Versican G1 domain enhances adenoviral-mediated transgene expression and can be modulated by inhibitors of the Janus kinase (JAK)/STAT and Src family kinase pathways
title Versican G1 domain enhances adenoviral-mediated transgene expression and can be modulated by inhibitors of the Janus kinase (JAK)/STAT and Src family kinase pathways
title_full Versican G1 domain enhances adenoviral-mediated transgene expression and can be modulated by inhibitors of the Janus kinase (JAK)/STAT and Src family kinase pathways
title_fullStr Versican G1 domain enhances adenoviral-mediated transgene expression and can be modulated by inhibitors of the Janus kinase (JAK)/STAT and Src family kinase pathways
title_full_unstemmed Versican G1 domain enhances adenoviral-mediated transgene expression and can be modulated by inhibitors of the Janus kinase (JAK)/STAT and Src family kinase pathways
title_short Versican G1 domain enhances adenoviral-mediated transgene expression and can be modulated by inhibitors of the Janus kinase (JAK)/STAT and Src family kinase pathways
title_sort versican g1 domain enhances adenoviral-mediated transgene expression and can be modulated by inhibitors of the janus kinase (jak)/stat and src family kinase pathways
topic Glycobiology and Extracellular Matrices
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5582833/
https://www.ncbi.nlm.nih.gov/pubmed/28684419
http://dx.doi.org/10.1074/jbc.M116.773549
work_keys_str_mv AT akinfenwapatriciay versicang1domainenhancesadenoviralmediatedtransgeneexpressionandcanbemodulatedbyinhibitorsofthejanuskinasejakstatandsrcfamilykinasepathways
AT bondwesleys versicang1domainenhancesadenoviralmediatedtransgeneexpressionandcanbemodulatedbyinhibitorsofthejanuskinasejakstatandsrcfamilykinasepathways
AT ildefonsocristhianj versicang1domainenhancesadenoviralmediatedtransgeneexpressionandcanbemodulatedbyinhibitorsofthejanuskinasejakstatandsrcfamilykinasepathways
AT hurwitzmaryy versicang1domainenhancesadenoviralmediatedtransgeneexpressionandcanbemodulatedbyinhibitorsofthejanuskinasejakstatandsrcfamilykinasepathways
AT hurwitzrichardl versicang1domainenhancesadenoviralmediatedtransgeneexpressionandcanbemodulatedbyinhibitorsofthejanuskinasejakstatandsrcfamilykinasepathways