Cargando…
Comparison of the Supreme™ and ProSeal™ laryngeal mask airways in infants: a prospective randomised clinical study
BACKGROUND: The Supreme™ and ProSeal™ laryngeal mask airways (LMAs) are widely used in paediatric anaesthesia; however, LMA use in infants is limited because many anaesthesiologists prefer to use tracheal intubation in infants. In this study, we compared the Supreme and ProSeal LMAs in infants by me...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2017
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5584514/ https://www.ncbi.nlm.nih.gov/pubmed/28870163 http://dx.doi.org/10.1186/s12871-017-0418-z |
_version_ | 1783261479771832320 |
---|---|
author | Oba, Sibel Turk, Hacer Sebnem Isil, Canan Tulay Erdogan, Huseyin Sayin, Pinar Dokucu, Ali Ihsan |
author_facet | Oba, Sibel Turk, Hacer Sebnem Isil, Canan Tulay Erdogan, Huseyin Sayin, Pinar Dokucu, Ali Ihsan |
author_sort | Oba, Sibel |
collection | PubMed |
description | BACKGROUND: The Supreme™ and ProSeal™ laryngeal mask airways (LMAs) are widely used in paediatric anaesthesia; however, LMA use in infants is limited because many anaesthesiologists prefer to use tracheal intubation in infants. In this study, we compared the Supreme and ProSeal LMAs in infants by measuring their performance characteristics, including insertion features, ventilation parameters, induced changes in haemodynamics and rates of postoperative complications. METHODS: Infants of ASA physical status I scheduled for elective, minor, lower abdominal surgery were divided into two groups: the Supreme LMA group and the ProSeal LMA group. Times and ease of LMA insertion were noted. The percentages of tidal volume leakage as well as peak, mean and leakage pressures for all infants were measured. Heart rate (HR), oxygen saturation (SpO2) and end tidal carbon dioxide (EtCO2) values were recorded before and after LMA insertion and before and after extubation. After extubation, complications and adverse effects were noted. RESULTS: Demographic and surgical data were similar between the two groups. LMA insertion times were shorter for the ProSeal group than for the Supreme group (P < 0.002). The mean HR value for the ProSeal group was lower than for the Supreme group (P < 0.011). Both the peak pressure and the leakage percentage for the ProSeal group were statistically lower than for the Supreme group. The leakage pressure for the ProSeal group was statistically higher than for the Supreme group (P < 0.001). CONCLUSIONS: The ProSeal LMA is superior to the Supreme LMA for use in infants due to the ease of insertion, high oropharyngeal leakage pressure and fewer induced changes in haemodynamics. TRIAL REGISTRATION: ClinicalTrial.gov, NCT03251105, retrospectively registered on 15 Aug 2017. |
format | Online Article Text |
id | pubmed-5584514 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2017 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-55845142017-09-06 Comparison of the Supreme™ and ProSeal™ laryngeal mask airways in infants: a prospective randomised clinical study Oba, Sibel Turk, Hacer Sebnem Isil, Canan Tulay Erdogan, Huseyin Sayin, Pinar Dokucu, Ali Ihsan BMC Anesthesiol Research Article BACKGROUND: The Supreme™ and ProSeal™ laryngeal mask airways (LMAs) are widely used in paediatric anaesthesia; however, LMA use in infants is limited because many anaesthesiologists prefer to use tracheal intubation in infants. In this study, we compared the Supreme and ProSeal LMAs in infants by measuring their performance characteristics, including insertion features, ventilation parameters, induced changes in haemodynamics and rates of postoperative complications. METHODS: Infants of ASA physical status I scheduled for elective, minor, lower abdominal surgery were divided into two groups: the Supreme LMA group and the ProSeal LMA group. Times and ease of LMA insertion were noted. The percentages of tidal volume leakage as well as peak, mean and leakage pressures for all infants were measured. Heart rate (HR), oxygen saturation (SpO2) and end tidal carbon dioxide (EtCO2) values were recorded before and after LMA insertion and before and after extubation. After extubation, complications and adverse effects were noted. RESULTS: Demographic and surgical data were similar between the two groups. LMA insertion times were shorter for the ProSeal group than for the Supreme group (P < 0.002). The mean HR value for the ProSeal group was lower than for the Supreme group (P < 0.011). Both the peak pressure and the leakage percentage for the ProSeal group were statistically lower than for the Supreme group. The leakage pressure for the ProSeal group was statistically higher than for the Supreme group (P < 0.001). CONCLUSIONS: The ProSeal LMA is superior to the Supreme LMA for use in infants due to the ease of insertion, high oropharyngeal leakage pressure and fewer induced changes in haemodynamics. TRIAL REGISTRATION: ClinicalTrial.gov, NCT03251105, retrospectively registered on 15 Aug 2017. BioMed Central 2017-09-05 /pmc/articles/PMC5584514/ /pubmed/28870163 http://dx.doi.org/10.1186/s12871-017-0418-z Text en © The Author(s). 2017 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Article Oba, Sibel Turk, Hacer Sebnem Isil, Canan Tulay Erdogan, Huseyin Sayin, Pinar Dokucu, Ali Ihsan Comparison of the Supreme™ and ProSeal™ laryngeal mask airways in infants: a prospective randomised clinical study |
title | Comparison of the Supreme™ and ProSeal™ laryngeal mask airways in infants: a prospective randomised clinical study |
title_full | Comparison of the Supreme™ and ProSeal™ laryngeal mask airways in infants: a prospective randomised clinical study |
title_fullStr | Comparison of the Supreme™ and ProSeal™ laryngeal mask airways in infants: a prospective randomised clinical study |
title_full_unstemmed | Comparison of the Supreme™ and ProSeal™ laryngeal mask airways in infants: a prospective randomised clinical study |
title_short | Comparison of the Supreme™ and ProSeal™ laryngeal mask airways in infants: a prospective randomised clinical study |
title_sort | comparison of the supreme™ and proseal™ laryngeal mask airways in infants: a prospective randomised clinical study |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5584514/ https://www.ncbi.nlm.nih.gov/pubmed/28870163 http://dx.doi.org/10.1186/s12871-017-0418-z |
work_keys_str_mv | AT obasibel comparisonofthesupremeandproseallaryngealmaskairwaysininfantsaprospectiverandomisedclinicalstudy AT turkhacersebnem comparisonofthesupremeandproseallaryngealmaskairwaysininfantsaprospectiverandomisedclinicalstudy AT isilcanantulay comparisonofthesupremeandproseallaryngealmaskairwaysininfantsaprospectiverandomisedclinicalstudy AT erdoganhuseyin comparisonofthesupremeandproseallaryngealmaskairwaysininfantsaprospectiverandomisedclinicalstudy AT sayinpinar comparisonofthesupremeandproseallaryngealmaskairwaysininfantsaprospectiverandomisedclinicalstudy AT dokucualiihsan comparisonofthesupremeandproseallaryngealmaskairwaysininfantsaprospectiverandomisedclinicalstudy |