Cargando…

Comparison of the Supreme™ and ProSeal™ laryngeal mask airways in infants: a prospective randomised clinical study

BACKGROUND: The Supreme™ and ProSeal™ laryngeal mask airways (LMAs) are widely used in paediatric anaesthesia; however, LMA use in infants is limited because many anaesthesiologists prefer to use tracheal intubation in infants. In this study, we compared the Supreme and ProSeal LMAs in infants by me...

Descripción completa

Detalles Bibliográficos
Autores principales: Oba, Sibel, Turk, Hacer Sebnem, Isil, Canan Tulay, Erdogan, Huseyin, Sayin, Pinar, Dokucu, Ali Ihsan
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2017
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5584514/
https://www.ncbi.nlm.nih.gov/pubmed/28870163
http://dx.doi.org/10.1186/s12871-017-0418-z
_version_ 1783261479771832320
author Oba, Sibel
Turk, Hacer Sebnem
Isil, Canan Tulay
Erdogan, Huseyin
Sayin, Pinar
Dokucu, Ali Ihsan
author_facet Oba, Sibel
Turk, Hacer Sebnem
Isil, Canan Tulay
Erdogan, Huseyin
Sayin, Pinar
Dokucu, Ali Ihsan
author_sort Oba, Sibel
collection PubMed
description BACKGROUND: The Supreme™ and ProSeal™ laryngeal mask airways (LMAs) are widely used in paediatric anaesthesia; however, LMA use in infants is limited because many anaesthesiologists prefer to use tracheal intubation in infants. In this study, we compared the Supreme and ProSeal LMAs in infants by measuring their performance characteristics, including insertion features, ventilation parameters, induced changes in haemodynamics and rates of postoperative complications. METHODS: Infants of ASA physical status I scheduled for elective, minor, lower abdominal surgery were divided into two groups: the Supreme LMA group and the ProSeal LMA group. Times and ease of LMA insertion were noted. The percentages of tidal volume leakage as well as peak, mean and leakage pressures for all infants were measured. Heart rate (HR), oxygen saturation (SpO2) and end tidal carbon dioxide (EtCO2) values were recorded before and after LMA insertion and before and after extubation. After extubation, complications and adverse effects were noted. RESULTS: Demographic and surgical data were similar between the two groups. LMA insertion times were shorter for the ProSeal group than for the Supreme group (P < 0.002). The mean HR value for the ProSeal group was lower than for the Supreme group (P < 0.011). Both the peak pressure and the leakage percentage for the ProSeal group were statistically lower than for the Supreme group. The leakage pressure for the ProSeal group was statistically higher than for the Supreme group (P < 0.001). CONCLUSIONS: The ProSeal LMA is superior to the Supreme LMA for use in infants due to the ease of insertion, high oropharyngeal leakage pressure and fewer induced changes in haemodynamics. TRIAL REGISTRATION: ClinicalTrial.gov, NCT03251105, retrospectively registered on 15 Aug 2017.
format Online
Article
Text
id pubmed-5584514
institution National Center for Biotechnology Information
language English
publishDate 2017
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-55845142017-09-06 Comparison of the Supreme™ and ProSeal™ laryngeal mask airways in infants: a prospective randomised clinical study Oba, Sibel Turk, Hacer Sebnem Isil, Canan Tulay Erdogan, Huseyin Sayin, Pinar Dokucu, Ali Ihsan BMC Anesthesiol Research Article BACKGROUND: The Supreme™ and ProSeal™ laryngeal mask airways (LMAs) are widely used in paediatric anaesthesia; however, LMA use in infants is limited because many anaesthesiologists prefer to use tracheal intubation in infants. In this study, we compared the Supreme and ProSeal LMAs in infants by measuring their performance characteristics, including insertion features, ventilation parameters, induced changes in haemodynamics and rates of postoperative complications. METHODS: Infants of ASA physical status I scheduled for elective, minor, lower abdominal surgery were divided into two groups: the Supreme LMA group and the ProSeal LMA group. Times and ease of LMA insertion were noted. The percentages of tidal volume leakage as well as peak, mean and leakage pressures for all infants were measured. Heart rate (HR), oxygen saturation (SpO2) and end tidal carbon dioxide (EtCO2) values were recorded before and after LMA insertion and before and after extubation. After extubation, complications and adverse effects were noted. RESULTS: Demographic and surgical data were similar between the two groups. LMA insertion times were shorter for the ProSeal group than for the Supreme group (P < 0.002). The mean HR value for the ProSeal group was lower than for the Supreme group (P < 0.011). Both the peak pressure and the leakage percentage for the ProSeal group were statistically lower than for the Supreme group. The leakage pressure for the ProSeal group was statistically higher than for the Supreme group (P < 0.001). CONCLUSIONS: The ProSeal LMA is superior to the Supreme LMA for use in infants due to the ease of insertion, high oropharyngeal leakage pressure and fewer induced changes in haemodynamics. TRIAL REGISTRATION: ClinicalTrial.gov, NCT03251105, retrospectively registered on 15 Aug 2017. BioMed Central 2017-09-05 /pmc/articles/PMC5584514/ /pubmed/28870163 http://dx.doi.org/10.1186/s12871-017-0418-z Text en © The Author(s). 2017 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research Article
Oba, Sibel
Turk, Hacer Sebnem
Isil, Canan Tulay
Erdogan, Huseyin
Sayin, Pinar
Dokucu, Ali Ihsan
Comparison of the Supreme™ and ProSeal™ laryngeal mask airways in infants: a prospective randomised clinical study
title Comparison of the Supreme™ and ProSeal™ laryngeal mask airways in infants: a prospective randomised clinical study
title_full Comparison of the Supreme™ and ProSeal™ laryngeal mask airways in infants: a prospective randomised clinical study
title_fullStr Comparison of the Supreme™ and ProSeal™ laryngeal mask airways in infants: a prospective randomised clinical study
title_full_unstemmed Comparison of the Supreme™ and ProSeal™ laryngeal mask airways in infants: a prospective randomised clinical study
title_short Comparison of the Supreme™ and ProSeal™ laryngeal mask airways in infants: a prospective randomised clinical study
title_sort comparison of the supreme™ and proseal™ laryngeal mask airways in infants: a prospective randomised clinical study
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5584514/
https://www.ncbi.nlm.nih.gov/pubmed/28870163
http://dx.doi.org/10.1186/s12871-017-0418-z
work_keys_str_mv AT obasibel comparisonofthesupremeandproseallaryngealmaskairwaysininfantsaprospectiverandomisedclinicalstudy
AT turkhacersebnem comparisonofthesupremeandproseallaryngealmaskairwaysininfantsaprospectiverandomisedclinicalstudy
AT isilcanantulay comparisonofthesupremeandproseallaryngealmaskairwaysininfantsaprospectiverandomisedclinicalstudy
AT erdoganhuseyin comparisonofthesupremeandproseallaryngealmaskairwaysininfantsaprospectiverandomisedclinicalstudy
AT sayinpinar comparisonofthesupremeandproseallaryngealmaskairwaysininfantsaprospectiverandomisedclinicalstudy
AT dokucualiihsan comparisonofthesupremeandproseallaryngealmaskairwaysininfantsaprospectiverandomisedclinicalstudy