Cargando…
Carbon dioxide hydrogenation catalysed by well-defined Mn(i) PNP pincer hydride complexes
The catalytic reduction of carbon dioxide is of great interest for its potential as a hydrogen storage method and to use carbon dioxide as C-1 feedstock. In an effort to replace expensive noble metal-based catalysts with efficient and cheap earth-abundant counterparts, we report the first example of...
Autores principales: | , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Royal Society of Chemistry
2017
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5613213/ https://www.ncbi.nlm.nih.gov/pubmed/28970889 http://dx.doi.org/10.1039/c7sc00209b |
_version_ | 1783266208434356224 |
---|---|
author | Bertini, Federica Glatz, Mathias Gorgas, Nikolaus Stöger, Berthold Peruzzini, Maurizio Veiros, Luis F. Kirchner, Karl Gonsalvi, Luca |
author_facet | Bertini, Federica Glatz, Mathias Gorgas, Nikolaus Stöger, Berthold Peruzzini, Maurizio Veiros, Luis F. Kirchner, Karl Gonsalvi, Luca |
author_sort | Bertini, Federica |
collection | PubMed |
description | The catalytic reduction of carbon dioxide is of great interest for its potential as a hydrogen storage method and to use carbon dioxide as C-1 feedstock. In an effort to replace expensive noble metal-based catalysts with efficient and cheap earth-abundant counterparts, we report the first example of Mn(i)-catalysed hydrogenation of CO(2) to HCOOH. The hydride Mn(i) catalyst [Mn(PNP(NH)-iPr)(H)(CO)(2)] showed higher stability and activity than its Fe(ii) analogue. TONs up to 10 000 and quantitative yields were obtained after 24 h using DBU as the base at 80 °C and 80 bar total pressure. At catalyst loadings as low as 0.002 mol%, TONs greater than 30 000 could be achieved in the presence of LiOTf as the co-catalyst, which are among the highest activities reported for base-metal catalysed CO(2) hydrogenations to date. |
format | Online Article Text |
id | pubmed-5613213 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2017 |
publisher | Royal Society of Chemistry |
record_format | MEDLINE/PubMed |
spelling | pubmed-56132132017-10-02 Carbon dioxide hydrogenation catalysed by well-defined Mn(i) PNP pincer hydride complexes Bertini, Federica Glatz, Mathias Gorgas, Nikolaus Stöger, Berthold Peruzzini, Maurizio Veiros, Luis F. Kirchner, Karl Gonsalvi, Luca Chem Sci Chemistry The catalytic reduction of carbon dioxide is of great interest for its potential as a hydrogen storage method and to use carbon dioxide as C-1 feedstock. In an effort to replace expensive noble metal-based catalysts with efficient and cheap earth-abundant counterparts, we report the first example of Mn(i)-catalysed hydrogenation of CO(2) to HCOOH. The hydride Mn(i) catalyst [Mn(PNP(NH)-iPr)(H)(CO)(2)] showed higher stability and activity than its Fe(ii) analogue. TONs up to 10 000 and quantitative yields were obtained after 24 h using DBU as the base at 80 °C and 80 bar total pressure. At catalyst loadings as low as 0.002 mol%, TONs greater than 30 000 could be achieved in the presence of LiOTf as the co-catalyst, which are among the highest activities reported for base-metal catalysed CO(2) hydrogenations to date. Royal Society of Chemistry 2017-07-01 2017-05-04 /pmc/articles/PMC5613213/ /pubmed/28970889 http://dx.doi.org/10.1039/c7sc00209b Text en This journal is © The Royal Society of Chemistry 2017 http://creativecommons.org/licenses/by-nc/3.0/ This is an Open Access article distributed under the terms of the Creative Commons Attribution-NonCommercial 3.0 Unported License (http://creativecommons.org/licenses/by-nc/3.0/) which permits unrestricted non-commercial use, distribution, and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Chemistry Bertini, Federica Glatz, Mathias Gorgas, Nikolaus Stöger, Berthold Peruzzini, Maurizio Veiros, Luis F. Kirchner, Karl Gonsalvi, Luca Carbon dioxide hydrogenation catalysed by well-defined Mn(i) PNP pincer hydride complexes |
title | Carbon dioxide hydrogenation catalysed by well-defined Mn(i) PNP pincer hydride complexes
|
title_full | Carbon dioxide hydrogenation catalysed by well-defined Mn(i) PNP pincer hydride complexes
|
title_fullStr | Carbon dioxide hydrogenation catalysed by well-defined Mn(i) PNP pincer hydride complexes
|
title_full_unstemmed | Carbon dioxide hydrogenation catalysed by well-defined Mn(i) PNP pincer hydride complexes
|
title_short | Carbon dioxide hydrogenation catalysed by well-defined Mn(i) PNP pincer hydride complexes
|
title_sort | carbon dioxide hydrogenation catalysed by well-defined mn(i) pnp pincer hydride complexes |
topic | Chemistry |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5613213/ https://www.ncbi.nlm.nih.gov/pubmed/28970889 http://dx.doi.org/10.1039/c7sc00209b |
work_keys_str_mv | AT bertinifederica carbondioxidehydrogenationcatalysedbywelldefinedmnipnppincerhydridecomplexes AT glatzmathias carbondioxidehydrogenationcatalysedbywelldefinedmnipnppincerhydridecomplexes AT gorgasnikolaus carbondioxidehydrogenationcatalysedbywelldefinedmnipnppincerhydridecomplexes AT stogerberthold carbondioxidehydrogenationcatalysedbywelldefinedmnipnppincerhydridecomplexes AT peruzzinimaurizio carbondioxidehydrogenationcatalysedbywelldefinedmnipnppincerhydridecomplexes AT veirosluisf carbondioxidehydrogenationcatalysedbywelldefinedmnipnppincerhydridecomplexes AT kirchnerkarl carbondioxidehydrogenationcatalysedbywelldefinedmnipnppincerhydridecomplexes AT gonsalviluca carbondioxidehydrogenationcatalysedbywelldefinedmnipnppincerhydridecomplexes |