Cargando…

Carbon dioxide hydrogenation catalysed by well-defined Mn(i) PNP pincer hydride complexes

The catalytic reduction of carbon dioxide is of great interest for its potential as a hydrogen storage method and to use carbon dioxide as C-1 feedstock. In an effort to replace expensive noble metal-based catalysts with efficient and cheap earth-abundant counterparts, we report the first example of...

Descripción completa

Detalles Bibliográficos
Autores principales: Bertini, Federica, Glatz, Mathias, Gorgas, Nikolaus, Stöger, Berthold, Peruzzini, Maurizio, Veiros, Luis F., Kirchner, Karl, Gonsalvi, Luca
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Royal Society of Chemistry 2017
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5613213/
https://www.ncbi.nlm.nih.gov/pubmed/28970889
http://dx.doi.org/10.1039/c7sc00209b
_version_ 1783266208434356224
author Bertini, Federica
Glatz, Mathias
Gorgas, Nikolaus
Stöger, Berthold
Peruzzini, Maurizio
Veiros, Luis F.
Kirchner, Karl
Gonsalvi, Luca
author_facet Bertini, Federica
Glatz, Mathias
Gorgas, Nikolaus
Stöger, Berthold
Peruzzini, Maurizio
Veiros, Luis F.
Kirchner, Karl
Gonsalvi, Luca
author_sort Bertini, Federica
collection PubMed
description The catalytic reduction of carbon dioxide is of great interest for its potential as a hydrogen storage method and to use carbon dioxide as C-1 feedstock. In an effort to replace expensive noble metal-based catalysts with efficient and cheap earth-abundant counterparts, we report the first example of Mn(i)-catalysed hydrogenation of CO(2) to HCOOH. The hydride Mn(i) catalyst [Mn(PNP(NH)-iPr)(H)(CO)(2)] showed higher stability and activity than its Fe(ii) analogue. TONs up to 10 000 and quantitative yields were obtained after 24 h using DBU as the base at 80 °C and 80 bar total pressure. At catalyst loadings as low as 0.002 mol%, TONs greater than 30 000 could be achieved in the presence of LiOTf as the co-catalyst, which are among the highest activities reported for base-metal catalysed CO(2) hydrogenations to date.
format Online
Article
Text
id pubmed-5613213
institution National Center for Biotechnology Information
language English
publishDate 2017
publisher Royal Society of Chemistry
record_format MEDLINE/PubMed
spelling pubmed-56132132017-10-02 Carbon dioxide hydrogenation catalysed by well-defined Mn(i) PNP pincer hydride complexes Bertini, Federica Glatz, Mathias Gorgas, Nikolaus Stöger, Berthold Peruzzini, Maurizio Veiros, Luis F. Kirchner, Karl Gonsalvi, Luca Chem Sci Chemistry The catalytic reduction of carbon dioxide is of great interest for its potential as a hydrogen storage method and to use carbon dioxide as C-1 feedstock. In an effort to replace expensive noble metal-based catalysts with efficient and cheap earth-abundant counterparts, we report the first example of Mn(i)-catalysed hydrogenation of CO(2) to HCOOH. The hydride Mn(i) catalyst [Mn(PNP(NH)-iPr)(H)(CO)(2)] showed higher stability and activity than its Fe(ii) analogue. TONs up to 10 000 and quantitative yields were obtained after 24 h using DBU as the base at 80 °C and 80 bar total pressure. At catalyst loadings as low as 0.002 mol%, TONs greater than 30 000 could be achieved in the presence of LiOTf as the co-catalyst, which are among the highest activities reported for base-metal catalysed CO(2) hydrogenations to date. Royal Society of Chemistry 2017-07-01 2017-05-04 /pmc/articles/PMC5613213/ /pubmed/28970889 http://dx.doi.org/10.1039/c7sc00209b Text en This journal is © The Royal Society of Chemistry 2017 http://creativecommons.org/licenses/by-nc/3.0/ This is an Open Access article distributed under the terms of the Creative Commons Attribution-NonCommercial 3.0 Unported License (http://creativecommons.org/licenses/by-nc/3.0/) which permits unrestricted non-commercial use, distribution, and reproduction in any medium, provided the original work is properly cited.
spellingShingle Chemistry
Bertini, Federica
Glatz, Mathias
Gorgas, Nikolaus
Stöger, Berthold
Peruzzini, Maurizio
Veiros, Luis F.
Kirchner, Karl
Gonsalvi, Luca
Carbon dioxide hydrogenation catalysed by well-defined Mn(i) PNP pincer hydride complexes
title Carbon dioxide hydrogenation catalysed by well-defined Mn(i) PNP pincer hydride complexes
title_full Carbon dioxide hydrogenation catalysed by well-defined Mn(i) PNP pincer hydride complexes
title_fullStr Carbon dioxide hydrogenation catalysed by well-defined Mn(i) PNP pincer hydride complexes
title_full_unstemmed Carbon dioxide hydrogenation catalysed by well-defined Mn(i) PNP pincer hydride complexes
title_short Carbon dioxide hydrogenation catalysed by well-defined Mn(i) PNP pincer hydride complexes
title_sort carbon dioxide hydrogenation catalysed by well-defined mn(i) pnp pincer hydride complexes
topic Chemistry
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5613213/
https://www.ncbi.nlm.nih.gov/pubmed/28970889
http://dx.doi.org/10.1039/c7sc00209b
work_keys_str_mv AT bertinifederica carbondioxidehydrogenationcatalysedbywelldefinedmnipnppincerhydridecomplexes
AT glatzmathias carbondioxidehydrogenationcatalysedbywelldefinedmnipnppincerhydridecomplexes
AT gorgasnikolaus carbondioxidehydrogenationcatalysedbywelldefinedmnipnppincerhydridecomplexes
AT stogerberthold carbondioxidehydrogenationcatalysedbywelldefinedmnipnppincerhydridecomplexes
AT peruzzinimaurizio carbondioxidehydrogenationcatalysedbywelldefinedmnipnppincerhydridecomplexes
AT veirosluisf carbondioxidehydrogenationcatalysedbywelldefinedmnipnppincerhydridecomplexes
AT kirchnerkarl carbondioxidehydrogenationcatalysedbywelldefinedmnipnppincerhydridecomplexes
AT gonsalviluca carbondioxidehydrogenationcatalysedbywelldefinedmnipnppincerhydridecomplexes