Cargando…
Correction to: Dubin–Johnson syndrome and intrahepatic cholestasis of pregnancy in a Sri Lankan family: a case report
| Autores principales: | , , , , , , , , , , |
|---|---|
| Formato: | Online Artículo Texto |
| Lenguaje: | English |
| Publicado: |
BioMed Central
2017
|
| Materias: | |
| Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5629802/ https://www.ncbi.nlm.nih.gov/pubmed/28982379 http://dx.doi.org/10.1186/s13104-017-2815-2 |
| _version_ | 1783269121339686912 |
|---|---|
| author | Kularatnam, Grace Angeline Malarnangai Warawitage, Hewa Dilanthi Vidanapathirana, Dinesha Maduri Jayasena, Subashini Jasinge, Eresha de Silva, Ginige Nalika Nirmalene Liyanarachchi, Kirinda Liyana Arachchige Manoj Sanjeeva Wickramasinghe, Pujitha Devgun, Manjit Singh Barbu, Veronique Lascols, Olivier |
| author_facet | Kularatnam, Grace Angeline Malarnangai Warawitage, Hewa Dilanthi Vidanapathirana, Dinesha Maduri Jayasena, Subashini Jasinge, Eresha de Silva, Ginige Nalika Nirmalene Liyanarachchi, Kirinda Liyana Arachchige Manoj Sanjeeva Wickramasinghe, Pujitha Devgun, Manjit Singh Barbu, Veronique Lascols, Olivier |
| author_sort | Kularatnam, Grace Angeline Malarnangai |
| collection | PubMed |
| description | |
| format | Online Article Text |
| id | pubmed-5629802 |
| institution | National Center for Biotechnology Information |
| language | English |
| publishDate | 2017 |
| publisher | BioMed Central |
| record_format | MEDLINE/PubMed |
| spelling | pubmed-56298022017-10-17 Correction to: Dubin–Johnson syndrome and intrahepatic cholestasis of pregnancy in a Sri Lankan family: a case report Kularatnam, Grace Angeline Malarnangai Warawitage, Hewa Dilanthi Vidanapathirana, Dinesha Maduri Jayasena, Subashini Jasinge, Eresha de Silva, Ginige Nalika Nirmalene Liyanarachchi, Kirinda Liyana Arachchige Manoj Sanjeeva Wickramasinghe, Pujitha Devgun, Manjit Singh Barbu, Veronique Lascols, Olivier BMC Res Notes Correction BioMed Central 2017-10-05 /pmc/articles/PMC5629802/ /pubmed/28982379 http://dx.doi.org/10.1186/s13104-017-2815-2 Text en © The Author(s) 2017 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
| spellingShingle | Correction Kularatnam, Grace Angeline Malarnangai Warawitage, Hewa Dilanthi Vidanapathirana, Dinesha Maduri Jayasena, Subashini Jasinge, Eresha de Silva, Ginige Nalika Nirmalene Liyanarachchi, Kirinda Liyana Arachchige Manoj Sanjeeva Wickramasinghe, Pujitha Devgun, Manjit Singh Barbu, Veronique Lascols, Olivier Correction to: Dubin–Johnson syndrome and intrahepatic cholestasis of pregnancy in a Sri Lankan family: a case report |
| title | Correction to: Dubin–Johnson syndrome and intrahepatic cholestasis of pregnancy in a Sri Lankan family: a case report |
| title_full | Correction to: Dubin–Johnson syndrome and intrahepatic cholestasis of pregnancy in a Sri Lankan family: a case report |
| title_fullStr | Correction to: Dubin–Johnson syndrome and intrahepatic cholestasis of pregnancy in a Sri Lankan family: a case report |
| title_full_unstemmed | Correction to: Dubin–Johnson syndrome and intrahepatic cholestasis of pregnancy in a Sri Lankan family: a case report |
| title_short | Correction to: Dubin–Johnson syndrome and intrahepatic cholestasis of pregnancy in a Sri Lankan family: a case report |
| title_sort | correction to: dubin–johnson syndrome and intrahepatic cholestasis of pregnancy in a sri lankan family: a case report |
| topic | Correction |
| url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5629802/ https://www.ncbi.nlm.nih.gov/pubmed/28982379 http://dx.doi.org/10.1186/s13104-017-2815-2 |
| work_keys_str_mv | AT kularatnamgraceangelinemalarnangai correctiontodubinjohnsonsyndromeandintrahepaticcholestasisofpregnancyinasrilankanfamilyacasereport AT warawitagehewadilanthi correctiontodubinjohnsonsyndromeandintrahepaticcholestasisofpregnancyinasrilankanfamilyacasereport AT vidanapathiranadineshamaduri correctiontodubinjohnsonsyndromeandintrahepaticcholestasisofpregnancyinasrilankanfamilyacasereport AT jayasenasubashini correctiontodubinjohnsonsyndromeandintrahepaticcholestasisofpregnancyinasrilankanfamilyacasereport AT jasingeeresha correctiontodubinjohnsonsyndromeandintrahepaticcholestasisofpregnancyinasrilankanfamilyacasereport AT desilvaginigenalikanirmalene correctiontodubinjohnsonsyndromeandintrahepaticcholestasisofpregnancyinasrilankanfamilyacasereport AT liyanarachchikirindaliyanaarachchigemanojsanjeeva correctiontodubinjohnsonsyndromeandintrahepaticcholestasisofpregnancyinasrilankanfamilyacasereport AT wickramasinghepujitha correctiontodubinjohnsonsyndromeandintrahepaticcholestasisofpregnancyinasrilankanfamilyacasereport AT devgunmanjitsingh correctiontodubinjohnsonsyndromeandintrahepaticcholestasisofpregnancyinasrilankanfamilyacasereport AT barbuveronique correctiontodubinjohnsonsyndromeandintrahepaticcholestasisofpregnancyinasrilankanfamilyacasereport AT lascolsolivier correctiontodubinjohnsonsyndromeandintrahepaticcholestasisofpregnancyinasrilankanfamilyacasereport |