Cargando…
Curcumin Attenuation of Wear Particle-Induced Osteolysis via RANKL Signaling Pathway Suppression in Mouse Calvarial Model
Wear particle-induced chronic inflammation and osteoclastogenesis are two critical factors in the osteolytic process. Curcumin (CUR) is an active compound of the medicinal herb Curcuma longa and has anti-inflammatory and antiosteoclastogenic properties. Our study tested the hypothesis that CUR might...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Hindawi
2017
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5632469/ https://www.ncbi.nlm.nih.gov/pubmed/29085185 http://dx.doi.org/10.1155/2017/5784374 |
_version_ | 1783269711231844352 |
---|---|
author | Cheng, Tao Zhao, Yaochao Li, Bin Cheng, Mengqi Wang, Jiaxing Zhang, Xianlong |
author_facet | Cheng, Tao Zhao, Yaochao Li, Bin Cheng, Mengqi Wang, Jiaxing Zhang, Xianlong |
author_sort | Cheng, Tao |
collection | PubMed |
description | Wear particle-induced chronic inflammation and osteoclastogenesis are two critical factors in the osteolytic process. Curcumin (CUR) is an active compound of the medicinal herb Curcuma longa and has anti-inflammatory and antiosteoclastogenic properties. Our study tested the hypothesis that CUR might attenuate polymethylmethacrylate- (PMMA-) induced inflammatory osteolysis using mouse calvaria osteolysis model in vivo and in vitro. The mice were divided into four groups: phosphate-buffered saline group, CUR, PMMA, and PMMA + CUR groups. Three days before PMMA particle implantation, the mice were intraperitoneally injected with CUR (25 mg/kg/day). Ten days after the operation, the mouse calvaria was harvested for microcomputed tomography, histomorphometry, and molecular biology analysis. As expected, CUR markedly reduced the secretion of tumor necrosis factor-α, interleukin- (IL-) 1β, and IL-6 in the calvarial organ culture. Moreover, CUR suppressed osteoclastogenesis and decreased bone resorption in vivo compared with PMMA-stimulated calvaria. Furthermore, CUR downregulated the osteoclast-specific gene expression and reversed the receptor activator of nuclear factor kappa-B ligand (RANKL)/osteoprotegerin messenger RNA and protein ratio in PMMA particle-stimulated mice. These results suggest that CUR attenuated PMMA particle-induced inflammatory osteolysis by suppressing the RANKL signaling pathway in the murine calvarium, which could be a candidate compound to prevent and treat AL. |
format | Online Article Text |
id | pubmed-5632469 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2017 |
publisher | Hindawi |
record_format | MEDLINE/PubMed |
spelling | pubmed-56324692017-10-30 Curcumin Attenuation of Wear Particle-Induced Osteolysis via RANKL Signaling Pathway Suppression in Mouse Calvarial Model Cheng, Tao Zhao, Yaochao Li, Bin Cheng, Mengqi Wang, Jiaxing Zhang, Xianlong Mediators Inflamm Research Article Wear particle-induced chronic inflammation and osteoclastogenesis are two critical factors in the osteolytic process. Curcumin (CUR) is an active compound of the medicinal herb Curcuma longa and has anti-inflammatory and antiosteoclastogenic properties. Our study tested the hypothesis that CUR might attenuate polymethylmethacrylate- (PMMA-) induced inflammatory osteolysis using mouse calvaria osteolysis model in vivo and in vitro. The mice were divided into four groups: phosphate-buffered saline group, CUR, PMMA, and PMMA + CUR groups. Three days before PMMA particle implantation, the mice were intraperitoneally injected with CUR (25 mg/kg/day). Ten days after the operation, the mouse calvaria was harvested for microcomputed tomography, histomorphometry, and molecular biology analysis. As expected, CUR markedly reduced the secretion of tumor necrosis factor-α, interleukin- (IL-) 1β, and IL-6 in the calvarial organ culture. Moreover, CUR suppressed osteoclastogenesis and decreased bone resorption in vivo compared with PMMA-stimulated calvaria. Furthermore, CUR downregulated the osteoclast-specific gene expression and reversed the receptor activator of nuclear factor kappa-B ligand (RANKL)/osteoprotegerin messenger RNA and protein ratio in PMMA particle-stimulated mice. These results suggest that CUR attenuated PMMA particle-induced inflammatory osteolysis by suppressing the RANKL signaling pathway in the murine calvarium, which could be a candidate compound to prevent and treat AL. Hindawi 2017 2017-09-20 /pmc/articles/PMC5632469/ /pubmed/29085185 http://dx.doi.org/10.1155/2017/5784374 Text en Copyright © 2017 Tao Cheng et al. http://creativecommons.org/licenses/by/4.0/ This is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Research Article Cheng, Tao Zhao, Yaochao Li, Bin Cheng, Mengqi Wang, Jiaxing Zhang, Xianlong Curcumin Attenuation of Wear Particle-Induced Osteolysis via RANKL Signaling Pathway Suppression in Mouse Calvarial Model |
title | Curcumin Attenuation of Wear Particle-Induced Osteolysis via RANKL Signaling Pathway Suppression in Mouse Calvarial Model |
title_full | Curcumin Attenuation of Wear Particle-Induced Osteolysis via RANKL Signaling Pathway Suppression in Mouse Calvarial Model |
title_fullStr | Curcumin Attenuation of Wear Particle-Induced Osteolysis via RANKL Signaling Pathway Suppression in Mouse Calvarial Model |
title_full_unstemmed | Curcumin Attenuation of Wear Particle-Induced Osteolysis via RANKL Signaling Pathway Suppression in Mouse Calvarial Model |
title_short | Curcumin Attenuation of Wear Particle-Induced Osteolysis via RANKL Signaling Pathway Suppression in Mouse Calvarial Model |
title_sort | curcumin attenuation of wear particle-induced osteolysis via rankl signaling pathway suppression in mouse calvarial model |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5632469/ https://www.ncbi.nlm.nih.gov/pubmed/29085185 http://dx.doi.org/10.1155/2017/5784374 |
work_keys_str_mv | AT chengtao curcuminattenuationofwearparticleinducedosteolysisviaranklsignalingpathwaysuppressioninmousecalvarialmodel AT zhaoyaochao curcuminattenuationofwearparticleinducedosteolysisviaranklsignalingpathwaysuppressioninmousecalvarialmodel AT libin curcuminattenuationofwearparticleinducedosteolysisviaranklsignalingpathwaysuppressioninmousecalvarialmodel AT chengmengqi curcuminattenuationofwearparticleinducedosteolysisviaranklsignalingpathwaysuppressioninmousecalvarialmodel AT wangjiaxing curcuminattenuationofwearparticleinducedosteolysisviaranklsignalingpathwaysuppressioninmousecalvarialmodel AT zhangxianlong curcuminattenuationofwearparticleinducedosteolysisviaranklsignalingpathwaysuppressioninmousecalvarialmodel |