Cargando…

Comparison of oropharyngeal leak pressure of air-Q™, i-gel™, and laryngeal mask airway supreme™ in adult patients during general anesthesia: A randomized controlled trial

STUDY OBJECTIVE: Various randomized controlled trials and a meta-analysis have compared i-gel™ and laryngeal mask airway Supreme™ (LMA-S™) in adult patients and found that both the devices provided equivalent oropharyngeal leak pressure (OLP). However, no randomized controlled trial has compared air...

Descripción completa

Detalles Bibliográficos
Autores principales: Damodaran, Srinath, Sethi, Sameer, Malhotra, Surender Kumar, Samra, Tanvir, Maitra, Souvik, Saini, Vikas
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Medknow Publications & Media Pvt Ltd 2017
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5637413/
https://www.ncbi.nlm.nih.gov/pubmed/29033717
http://dx.doi.org/10.4103/sja.SJA_149_17
_version_ 1783270616002985984
author Damodaran, Srinath
Sethi, Sameer
Malhotra, Surender Kumar
Samra, Tanvir
Maitra, Souvik
Saini, Vikas
author_facet Damodaran, Srinath
Sethi, Sameer
Malhotra, Surender Kumar
Samra, Tanvir
Maitra, Souvik
Saini, Vikas
author_sort Damodaran, Srinath
collection PubMed
description STUDY OBJECTIVE: Various randomized controlled trials and a meta-analysis have compared i-gel™ and laryngeal mask airway Supreme™ (LMA-S™) in adult patients and found that both the devices provided equivalent oropharyngeal leak pressure (OLP). However, no randomized controlled trial has compared air-Q™ with i-gel™ and LMA-S™ in adult patient. Hence, we designed this study to compare air-Q™ with LMA-S™ and i-gel™ in adult patients. MATERIALS AND METHODS: A total of 75 adult patients of the American Society of Anesthesiologists physical status I/II of both sexes, between 18 and 60 years, were included in this prospective randomized controlled trial conducted in a tertiary care center. Randomization of patients was done in three equal groups according to the insertion of supraglottic airway device by a computer-generated random number sequence: group air-Q™ (n = 25), group i-gel™ (n = 25), and group LMA-S™ (n = 25). Primary outcome of this study was OLP. We also recorded time for successful placement of device, ease of device insertion, number of attempts to insert device, and ease of gastric tube insertion along with postoperative complications. RESULTS: The mean ± standard deviation OLP of air-Q™, i-gel™, and LMA-S™ was 26.13 ± 4.957 cm, 23.75 ± 5.439 cm, and 24.80 ± 4.78 cm H(2)O (P = 0.279). The first insertion success rate for air-Q™, i-gel™, and LMA-S™ was 80%, 76%, and 92%, respectively (P = 0.353). The insertion time of air-Q™, i-gel™, and LMA-S™ was 20.6 ± 4.4, 14.8 ± 5.4, and 15.2 ± 4.7 s, respectively (P = 0.000). Time taken for air-Q™ insertion was significantly higher than time taken for i-gel™ (mean difference 5.8 s, P < 0.0001) and LMA-S™ (mean difference 5.4 s, P = 0.0001) insertion. Postoperative complications were similar with all three devices. CONCLUSIONS: We concluded that air-Q™, i-gel™, and LMA-S™ were equally efficacious in terms of routine airway management in adult patients with normal airway anatomy.
format Online
Article
Text
id pubmed-5637413
institution National Center for Biotechnology Information
language English
publishDate 2017
publisher Medknow Publications & Media Pvt Ltd
record_format MEDLINE/PubMed
spelling pubmed-56374132017-10-13 Comparison of oropharyngeal leak pressure of air-Q™, i-gel™, and laryngeal mask airway supreme™ in adult patients during general anesthesia: A randomized controlled trial Damodaran, Srinath Sethi, Sameer Malhotra, Surender Kumar Samra, Tanvir Maitra, Souvik Saini, Vikas Saudi J Anaesth Original Article STUDY OBJECTIVE: Various randomized controlled trials and a meta-analysis have compared i-gel™ and laryngeal mask airway Supreme™ (LMA-S™) in adult patients and found that both the devices provided equivalent oropharyngeal leak pressure (OLP). However, no randomized controlled trial has compared air-Q™ with i-gel™ and LMA-S™ in adult patient. Hence, we designed this study to compare air-Q™ with LMA-S™ and i-gel™ in adult patients. MATERIALS AND METHODS: A total of 75 adult patients of the American Society of Anesthesiologists physical status I/II of both sexes, between 18 and 60 years, were included in this prospective randomized controlled trial conducted in a tertiary care center. Randomization of patients was done in three equal groups according to the insertion of supraglottic airway device by a computer-generated random number sequence: group air-Q™ (n = 25), group i-gel™ (n = 25), and group LMA-S™ (n = 25). Primary outcome of this study was OLP. We also recorded time for successful placement of device, ease of device insertion, number of attempts to insert device, and ease of gastric tube insertion along with postoperative complications. RESULTS: The mean ± standard deviation OLP of air-Q™, i-gel™, and LMA-S™ was 26.13 ± 4.957 cm, 23.75 ± 5.439 cm, and 24.80 ± 4.78 cm H(2)O (P = 0.279). The first insertion success rate for air-Q™, i-gel™, and LMA-S™ was 80%, 76%, and 92%, respectively (P = 0.353). The insertion time of air-Q™, i-gel™, and LMA-S™ was 20.6 ± 4.4, 14.8 ± 5.4, and 15.2 ± 4.7 s, respectively (P = 0.000). Time taken for air-Q™ insertion was significantly higher than time taken for i-gel™ (mean difference 5.8 s, P < 0.0001) and LMA-S™ (mean difference 5.4 s, P = 0.0001) insertion. Postoperative complications were similar with all three devices. CONCLUSIONS: We concluded that air-Q™, i-gel™, and LMA-S™ were equally efficacious in terms of routine airway management in adult patients with normal airway anatomy. Medknow Publications & Media Pvt Ltd 2017 /pmc/articles/PMC5637413/ /pubmed/29033717 http://dx.doi.org/10.4103/sja.SJA_149_17 Text en Copyright: © 2017 Saudi Journal of Anaesthesia http://creativecommons.org/licenses/by-nc-sa/3.0 This is an open access article distributed under the terms of the Creative Commons Attribution-NonCommercial-ShareAlike 3.0 License, which allows others to remix, tweak, and build upon the work non-commercially, as long as the author is credited and the new creations are licensed under the identical terms.
spellingShingle Original Article
Damodaran, Srinath
Sethi, Sameer
Malhotra, Surender Kumar
Samra, Tanvir
Maitra, Souvik
Saini, Vikas
Comparison of oropharyngeal leak pressure of air-Q™, i-gel™, and laryngeal mask airway supreme™ in adult patients during general anesthesia: A randomized controlled trial
title Comparison of oropharyngeal leak pressure of air-Q™, i-gel™, and laryngeal mask airway supreme™ in adult patients during general anesthesia: A randomized controlled trial
title_full Comparison of oropharyngeal leak pressure of air-Q™, i-gel™, and laryngeal mask airway supreme™ in adult patients during general anesthesia: A randomized controlled trial
title_fullStr Comparison of oropharyngeal leak pressure of air-Q™, i-gel™, and laryngeal mask airway supreme™ in adult patients during general anesthesia: A randomized controlled trial
title_full_unstemmed Comparison of oropharyngeal leak pressure of air-Q™, i-gel™, and laryngeal mask airway supreme™ in adult patients during general anesthesia: A randomized controlled trial
title_short Comparison of oropharyngeal leak pressure of air-Q™, i-gel™, and laryngeal mask airway supreme™ in adult patients during general anesthesia: A randomized controlled trial
title_sort comparison of oropharyngeal leak pressure of air-q™, i-gel™, and laryngeal mask airway supreme™ in adult patients during general anesthesia: a randomized controlled trial
topic Original Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5637413/
https://www.ncbi.nlm.nih.gov/pubmed/29033717
http://dx.doi.org/10.4103/sja.SJA_149_17
work_keys_str_mv AT damodaransrinath comparisonoforopharyngealleakpressureofairqigelandlaryngealmaskairwaysupremeinadultpatientsduringgeneralanesthesiaarandomizedcontrolledtrial
AT sethisameer comparisonoforopharyngealleakpressureofairqigelandlaryngealmaskairwaysupremeinadultpatientsduringgeneralanesthesiaarandomizedcontrolledtrial
AT malhotrasurenderkumar comparisonoforopharyngealleakpressureofairqigelandlaryngealmaskairwaysupremeinadultpatientsduringgeneralanesthesiaarandomizedcontrolledtrial
AT samratanvir comparisonoforopharyngealleakpressureofairqigelandlaryngealmaskairwaysupremeinadultpatientsduringgeneralanesthesiaarandomizedcontrolledtrial
AT maitrasouvik comparisonoforopharyngealleakpressureofairqigelandlaryngealmaskairwaysupremeinadultpatientsduringgeneralanesthesiaarandomizedcontrolledtrial
AT sainivikas comparisonoforopharyngealleakpressureofairqigelandlaryngealmaskairwaysupremeinadultpatientsduringgeneralanesthesiaarandomizedcontrolledtrial