Cargando…

Conjugation with L,L-diphenylalanine Self-Assemblies Enhances In Vitro Antitumor Activity of Phthalocyanine Photosensitizer

We present the synthesis and characterization of new peptide conjugates obtained by hierarchical co-assembly of L,L-diphenylalanine (FF) and zinc phthalocyanine complexes (ZnPc) in water. Self-assembly capabilities under defined conditions were investigated by scanning electron microscopy, and photo...

Descripción completa

Detalles Bibliográficos
Autores principales: Souza, Márcia I., Prieto, Tatiana, Rodrigues, Tiago, Ferreira, Fabio F., Nascimento, Francisco B., Ribeiro, Anderson O., Silva, Emerson R., Giuntini, Francesca, Alves, Wendel A.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Nature Publishing Group UK 2017
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5640658/
https://www.ncbi.nlm.nih.gov/pubmed/29030603
http://dx.doi.org/10.1038/s41598-017-13729-x
_version_ 1783271071266373632
author Souza, Márcia I.
Prieto, Tatiana
Rodrigues, Tiago
Ferreira, Fabio F.
Nascimento, Francisco B.
Ribeiro, Anderson O.
Silva, Emerson R.
Giuntini, Francesca
Alves, Wendel A.
author_facet Souza, Márcia I.
Prieto, Tatiana
Rodrigues, Tiago
Ferreira, Fabio F.
Nascimento, Francisco B.
Ribeiro, Anderson O.
Silva, Emerson R.
Giuntini, Francesca
Alves, Wendel A.
author_sort Souza, Márcia I.
collection PubMed
description We present the synthesis and characterization of new peptide conjugates obtained by hierarchical co-assembly of L,L-diphenylalanine (FF) and zinc phthalocyanine complexes (ZnPc) in water. Self-assembly capabilities under defined conditions were investigated by scanning electron microscopy, and photophysical properties were evaluated using UV-Vis and fluorescence spectroscopy. AFM observations demonstrated that these ZnPcs form different highly ordered arrays on the crystalline faces of the FF microplates and that surface roughness significantly changes with the presence of differently substituted phthalocyanine units. XRD assays showed that the overall molecular packing of the conjugates is organized according to a hexagonal symmetry, with ZnPcs hosted in the interstices of the peptide phase. In vitro photodynamic studies were conducted on human breast cancer MCF-7 cells to investigate both cellular uptake and cytotoxicity. It was shown that FF self-assemblies are not toxicity and enhance accumulation of ZnPc in MCF-7 cells, improving apoptotic cell death upon irradiation. Our findings demonstrate enhancement of ZnPc antitumor efficiency by FF conjugates and a proof-of-concept for new photosensitizer carriers based on peptide conjugates.
format Online
Article
Text
id pubmed-5640658
institution National Center for Biotechnology Information
language English
publishDate 2017
publisher Nature Publishing Group UK
record_format MEDLINE/PubMed
spelling pubmed-56406582017-10-18 Conjugation with L,L-diphenylalanine Self-Assemblies Enhances In Vitro Antitumor Activity of Phthalocyanine Photosensitizer Souza, Márcia I. Prieto, Tatiana Rodrigues, Tiago Ferreira, Fabio F. Nascimento, Francisco B. Ribeiro, Anderson O. Silva, Emerson R. Giuntini, Francesca Alves, Wendel A. Sci Rep Article We present the synthesis and characterization of new peptide conjugates obtained by hierarchical co-assembly of L,L-diphenylalanine (FF) and zinc phthalocyanine complexes (ZnPc) in water. Self-assembly capabilities under defined conditions were investigated by scanning electron microscopy, and photophysical properties were evaluated using UV-Vis and fluorescence spectroscopy. AFM observations demonstrated that these ZnPcs form different highly ordered arrays on the crystalline faces of the FF microplates and that surface roughness significantly changes with the presence of differently substituted phthalocyanine units. XRD assays showed that the overall molecular packing of the conjugates is organized according to a hexagonal symmetry, with ZnPcs hosted in the interstices of the peptide phase. In vitro photodynamic studies were conducted on human breast cancer MCF-7 cells to investigate both cellular uptake and cytotoxicity. It was shown that FF self-assemblies are not toxicity and enhance accumulation of ZnPc in MCF-7 cells, improving apoptotic cell death upon irradiation. Our findings demonstrate enhancement of ZnPc antitumor efficiency by FF conjugates and a proof-of-concept for new photosensitizer carriers based on peptide conjugates. Nature Publishing Group UK 2017-10-13 /pmc/articles/PMC5640658/ /pubmed/29030603 http://dx.doi.org/10.1038/s41598-017-13729-x Text en © The Author(s) 2017 Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The images or other third party material in this article are included in the article’s Creative Commons license, unless indicated otherwise in a credit line to the material. If material is not included in the article’s Creative Commons license and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this license, visit http://creativecommons.org/licenses/by/4.0/.
spellingShingle Article
Souza, Márcia I.
Prieto, Tatiana
Rodrigues, Tiago
Ferreira, Fabio F.
Nascimento, Francisco B.
Ribeiro, Anderson O.
Silva, Emerson R.
Giuntini, Francesca
Alves, Wendel A.
Conjugation with L,L-diphenylalanine Self-Assemblies Enhances In Vitro Antitumor Activity of Phthalocyanine Photosensitizer
title Conjugation with L,L-diphenylalanine Self-Assemblies Enhances In Vitro Antitumor Activity of Phthalocyanine Photosensitizer
title_full Conjugation with L,L-diphenylalanine Self-Assemblies Enhances In Vitro Antitumor Activity of Phthalocyanine Photosensitizer
title_fullStr Conjugation with L,L-diphenylalanine Self-Assemblies Enhances In Vitro Antitumor Activity of Phthalocyanine Photosensitizer
title_full_unstemmed Conjugation with L,L-diphenylalanine Self-Assemblies Enhances In Vitro Antitumor Activity of Phthalocyanine Photosensitizer
title_short Conjugation with L,L-diphenylalanine Self-Assemblies Enhances In Vitro Antitumor Activity of Phthalocyanine Photosensitizer
title_sort conjugation with l,l-diphenylalanine self-assemblies enhances in vitro antitumor activity of phthalocyanine photosensitizer
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5640658/
https://www.ncbi.nlm.nih.gov/pubmed/29030603
http://dx.doi.org/10.1038/s41598-017-13729-x
work_keys_str_mv AT souzamarciai conjugationwithlldiphenylalanineselfassembliesenhancesinvitroantitumoractivityofphthalocyaninephotosensitizer
AT prietotatiana conjugationwithlldiphenylalanineselfassembliesenhancesinvitroantitumoractivityofphthalocyaninephotosensitizer
AT rodriguestiago conjugationwithlldiphenylalanineselfassembliesenhancesinvitroantitumoractivityofphthalocyaninephotosensitizer
AT ferreirafabiof conjugationwithlldiphenylalanineselfassembliesenhancesinvitroantitumoractivityofphthalocyaninephotosensitizer
AT nascimentofranciscob conjugationwithlldiphenylalanineselfassembliesenhancesinvitroantitumoractivityofphthalocyaninephotosensitizer
AT ribeiroandersono conjugationwithlldiphenylalanineselfassembliesenhancesinvitroantitumoractivityofphthalocyaninephotosensitizer
AT silvaemersonr conjugationwithlldiphenylalanineselfassembliesenhancesinvitroantitumoractivityofphthalocyaninephotosensitizer
AT giuntinifrancesca conjugationwithlldiphenylalanineselfassembliesenhancesinvitroantitumoractivityofphthalocyaninephotosensitizer
AT alveswendela conjugationwithlldiphenylalanineselfassembliesenhancesinvitroantitumoractivityofphthalocyaninephotosensitizer