Cargando…

The current management of acute uncomplicated appendicitis: should there be a change in paradigm? A systematic review of the literatures and analysis of treatment performance

INTRODUCTION: Appendectomy has long been the mainstay of intervention for acute appendicitis, aiming at preventing perforation, peritonitis, abscess formation and recurrence. With better understanding of the disease process, non-operative management (NOM) with antibiotics alone has been proved a fea...

Descripción completa

Detalles Bibliográficos
Autores principales: Poon, Samuel Ho Ting, Lee, Jennifer Wah Yan, NG, Ka Man, Chiu, Gloria Wing Yan, Wong, Brian Yung Kong, Foo, Chi Chung, Law, Wai Lun
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2017
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5644137/
https://www.ncbi.nlm.nih.gov/pubmed/29075315
http://dx.doi.org/10.1186/s13017-017-0157-y
_version_ 1783271672987516928
author Poon, Samuel Ho Ting
Lee, Jennifer Wah Yan
NG, Ka Man
Chiu, Gloria Wing Yan
Wong, Brian Yung Kong
Foo, Chi Chung
Law, Wai Lun
author_facet Poon, Samuel Ho Ting
Lee, Jennifer Wah Yan
NG, Ka Man
Chiu, Gloria Wing Yan
Wong, Brian Yung Kong
Foo, Chi Chung
Law, Wai Lun
author_sort Poon, Samuel Ho Ting
collection PubMed
description INTRODUCTION: Appendectomy has long been the mainstay of intervention for acute appendicitis, aiming at preventing perforation, peritonitis, abscess formation and recurrence. With better understanding of the disease process, non-operative management (NOM) with antibiotics alone has been proved a feasible treatment for uncomplicated appendicitis. This article aimed at systematically reviewing the available literatures and discussing the question whether NOM should replace appendectomy as the standard first-line treatment for uncomplicated appendicitis. METHOD: A search of the Embase, Pubmed and Cochrane Library was performed using the keywords ‘acute appendicitis’ and ‘antibiotic therapy’. Meta-analysis with inverse variance model for continuous variable and Mantel Haenzel Model for dichotomous variable was performed to evaluate the one year treatment efficacy, morbidities rate, sick leave duration and length of hospital stay associated with emergency appendectomy and NOM. RESULTS: Six randomized control trials were identified out of 1943 publications. NOM had a significant lower treatment efficacy rate at one year, 0.10 (95% CI 0.03–0.36, p < 0.01), when compared to appendectomy. The morbidities rate was comparable between the two interventions. The length of hospital stay was longer, with a mean difference of 1.08 days (95% CI 0.09–2.07, p = 0.03), and the sick leave duration was shorter, a mean difference of 3.37 days (95% CI -5.90 to −0.85 days, p < 0.01) for NOM. CONCLUSION: The paradigm remains unchanged, that appendectomy is the gold standard of treatment for uncomplicated appendicitis, given its higher efficacy rate when compared to NOM.
format Online
Article
Text
id pubmed-5644137
institution National Center for Biotechnology Information
language English
publishDate 2017
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-56441372017-10-26 The current management of acute uncomplicated appendicitis: should there be a change in paradigm? A systematic review of the literatures and analysis of treatment performance Poon, Samuel Ho Ting Lee, Jennifer Wah Yan NG, Ka Man Chiu, Gloria Wing Yan Wong, Brian Yung Kong Foo, Chi Chung Law, Wai Lun World J Emerg Surg Review INTRODUCTION: Appendectomy has long been the mainstay of intervention for acute appendicitis, aiming at preventing perforation, peritonitis, abscess formation and recurrence. With better understanding of the disease process, non-operative management (NOM) with antibiotics alone has been proved a feasible treatment for uncomplicated appendicitis. This article aimed at systematically reviewing the available literatures and discussing the question whether NOM should replace appendectomy as the standard first-line treatment for uncomplicated appendicitis. METHOD: A search of the Embase, Pubmed and Cochrane Library was performed using the keywords ‘acute appendicitis’ and ‘antibiotic therapy’. Meta-analysis with inverse variance model for continuous variable and Mantel Haenzel Model for dichotomous variable was performed to evaluate the one year treatment efficacy, morbidities rate, sick leave duration and length of hospital stay associated with emergency appendectomy and NOM. RESULTS: Six randomized control trials were identified out of 1943 publications. NOM had a significant lower treatment efficacy rate at one year, 0.10 (95% CI 0.03–0.36, p < 0.01), when compared to appendectomy. The morbidities rate was comparable between the two interventions. The length of hospital stay was longer, with a mean difference of 1.08 days (95% CI 0.09–2.07, p = 0.03), and the sick leave duration was shorter, a mean difference of 3.37 days (95% CI -5.90 to −0.85 days, p < 0.01) for NOM. CONCLUSION: The paradigm remains unchanged, that appendectomy is the gold standard of treatment for uncomplicated appendicitis, given its higher efficacy rate when compared to NOM. BioMed Central 2017-10-16 /pmc/articles/PMC5644137/ /pubmed/29075315 http://dx.doi.org/10.1186/s13017-017-0157-y Text en © The Author(s). 2017 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Review
Poon, Samuel Ho Ting
Lee, Jennifer Wah Yan
NG, Ka Man
Chiu, Gloria Wing Yan
Wong, Brian Yung Kong
Foo, Chi Chung
Law, Wai Lun
The current management of acute uncomplicated appendicitis: should there be a change in paradigm? A systematic review of the literatures and analysis of treatment performance
title The current management of acute uncomplicated appendicitis: should there be a change in paradigm? A systematic review of the literatures and analysis of treatment performance
title_full The current management of acute uncomplicated appendicitis: should there be a change in paradigm? A systematic review of the literatures and analysis of treatment performance
title_fullStr The current management of acute uncomplicated appendicitis: should there be a change in paradigm? A systematic review of the literatures and analysis of treatment performance
title_full_unstemmed The current management of acute uncomplicated appendicitis: should there be a change in paradigm? A systematic review of the literatures and analysis of treatment performance
title_short The current management of acute uncomplicated appendicitis: should there be a change in paradigm? A systematic review of the literatures and analysis of treatment performance
title_sort current management of acute uncomplicated appendicitis: should there be a change in paradigm? a systematic review of the literatures and analysis of treatment performance
topic Review
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5644137/
https://www.ncbi.nlm.nih.gov/pubmed/29075315
http://dx.doi.org/10.1186/s13017-017-0157-y
work_keys_str_mv AT poonsamuelhoting thecurrentmanagementofacuteuncomplicatedappendicitisshouldtherebeachangeinparadigmasystematicreviewoftheliteraturesandanalysisoftreatmentperformance
AT leejenniferwahyan thecurrentmanagementofacuteuncomplicatedappendicitisshouldtherebeachangeinparadigmasystematicreviewoftheliteraturesandanalysisoftreatmentperformance
AT ngkaman thecurrentmanagementofacuteuncomplicatedappendicitisshouldtherebeachangeinparadigmasystematicreviewoftheliteraturesandanalysisoftreatmentperformance
AT chiugloriawingyan thecurrentmanagementofacuteuncomplicatedappendicitisshouldtherebeachangeinparadigmasystematicreviewoftheliteraturesandanalysisoftreatmentperformance
AT wongbrianyungkong thecurrentmanagementofacuteuncomplicatedappendicitisshouldtherebeachangeinparadigmasystematicreviewoftheliteraturesandanalysisoftreatmentperformance
AT foochichung thecurrentmanagementofacuteuncomplicatedappendicitisshouldtherebeachangeinparadigmasystematicreviewoftheliteraturesandanalysisoftreatmentperformance
AT lawwailun thecurrentmanagementofacuteuncomplicatedappendicitisshouldtherebeachangeinparadigmasystematicreviewoftheliteraturesandanalysisoftreatmentperformance
AT poonsamuelhoting currentmanagementofacuteuncomplicatedappendicitisshouldtherebeachangeinparadigmasystematicreviewoftheliteraturesandanalysisoftreatmentperformance
AT leejenniferwahyan currentmanagementofacuteuncomplicatedappendicitisshouldtherebeachangeinparadigmasystematicreviewoftheliteraturesandanalysisoftreatmentperformance
AT ngkaman currentmanagementofacuteuncomplicatedappendicitisshouldtherebeachangeinparadigmasystematicreviewoftheliteraturesandanalysisoftreatmentperformance
AT chiugloriawingyan currentmanagementofacuteuncomplicatedappendicitisshouldtherebeachangeinparadigmasystematicreviewoftheliteraturesandanalysisoftreatmentperformance
AT wongbrianyungkong currentmanagementofacuteuncomplicatedappendicitisshouldtherebeachangeinparadigmasystematicreviewoftheliteraturesandanalysisoftreatmentperformance
AT foochichung currentmanagementofacuteuncomplicatedappendicitisshouldtherebeachangeinparadigmasystematicreviewoftheliteraturesandanalysisoftreatmentperformance
AT lawwailun currentmanagementofacuteuncomplicatedappendicitisshouldtherebeachangeinparadigmasystematicreviewoftheliteraturesandanalysisoftreatmentperformance