Cargando…
The current management of acute uncomplicated appendicitis: should there be a change in paradigm? A systematic review of the literatures and analysis of treatment performance
INTRODUCTION: Appendectomy has long been the mainstay of intervention for acute appendicitis, aiming at preventing perforation, peritonitis, abscess formation and recurrence. With better understanding of the disease process, non-operative management (NOM) with antibiotics alone has been proved a fea...
Autores principales: | , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2017
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5644137/ https://www.ncbi.nlm.nih.gov/pubmed/29075315 http://dx.doi.org/10.1186/s13017-017-0157-y |
_version_ | 1783271672987516928 |
---|---|
author | Poon, Samuel Ho Ting Lee, Jennifer Wah Yan NG, Ka Man Chiu, Gloria Wing Yan Wong, Brian Yung Kong Foo, Chi Chung Law, Wai Lun |
author_facet | Poon, Samuel Ho Ting Lee, Jennifer Wah Yan NG, Ka Man Chiu, Gloria Wing Yan Wong, Brian Yung Kong Foo, Chi Chung Law, Wai Lun |
author_sort | Poon, Samuel Ho Ting |
collection | PubMed |
description | INTRODUCTION: Appendectomy has long been the mainstay of intervention for acute appendicitis, aiming at preventing perforation, peritonitis, abscess formation and recurrence. With better understanding of the disease process, non-operative management (NOM) with antibiotics alone has been proved a feasible treatment for uncomplicated appendicitis. This article aimed at systematically reviewing the available literatures and discussing the question whether NOM should replace appendectomy as the standard first-line treatment for uncomplicated appendicitis. METHOD: A search of the Embase, Pubmed and Cochrane Library was performed using the keywords ‘acute appendicitis’ and ‘antibiotic therapy’. Meta-analysis with inverse variance model for continuous variable and Mantel Haenzel Model for dichotomous variable was performed to evaluate the one year treatment efficacy, morbidities rate, sick leave duration and length of hospital stay associated with emergency appendectomy and NOM. RESULTS: Six randomized control trials were identified out of 1943 publications. NOM had a significant lower treatment efficacy rate at one year, 0.10 (95% CI 0.03–0.36, p < 0.01), when compared to appendectomy. The morbidities rate was comparable between the two interventions. The length of hospital stay was longer, with a mean difference of 1.08 days (95% CI 0.09–2.07, p = 0.03), and the sick leave duration was shorter, a mean difference of 3.37 days (95% CI -5.90 to −0.85 days, p < 0.01) for NOM. CONCLUSION: The paradigm remains unchanged, that appendectomy is the gold standard of treatment for uncomplicated appendicitis, given its higher efficacy rate when compared to NOM. |
format | Online Article Text |
id | pubmed-5644137 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2017 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-56441372017-10-26 The current management of acute uncomplicated appendicitis: should there be a change in paradigm? A systematic review of the literatures and analysis of treatment performance Poon, Samuel Ho Ting Lee, Jennifer Wah Yan NG, Ka Man Chiu, Gloria Wing Yan Wong, Brian Yung Kong Foo, Chi Chung Law, Wai Lun World J Emerg Surg Review INTRODUCTION: Appendectomy has long been the mainstay of intervention for acute appendicitis, aiming at preventing perforation, peritonitis, abscess formation and recurrence. With better understanding of the disease process, non-operative management (NOM) with antibiotics alone has been proved a feasible treatment for uncomplicated appendicitis. This article aimed at systematically reviewing the available literatures and discussing the question whether NOM should replace appendectomy as the standard first-line treatment for uncomplicated appendicitis. METHOD: A search of the Embase, Pubmed and Cochrane Library was performed using the keywords ‘acute appendicitis’ and ‘antibiotic therapy’. Meta-analysis with inverse variance model for continuous variable and Mantel Haenzel Model for dichotomous variable was performed to evaluate the one year treatment efficacy, morbidities rate, sick leave duration and length of hospital stay associated with emergency appendectomy and NOM. RESULTS: Six randomized control trials were identified out of 1943 publications. NOM had a significant lower treatment efficacy rate at one year, 0.10 (95% CI 0.03–0.36, p < 0.01), when compared to appendectomy. The morbidities rate was comparable between the two interventions. The length of hospital stay was longer, with a mean difference of 1.08 days (95% CI 0.09–2.07, p = 0.03), and the sick leave duration was shorter, a mean difference of 3.37 days (95% CI -5.90 to −0.85 days, p < 0.01) for NOM. CONCLUSION: The paradigm remains unchanged, that appendectomy is the gold standard of treatment for uncomplicated appendicitis, given its higher efficacy rate when compared to NOM. BioMed Central 2017-10-16 /pmc/articles/PMC5644137/ /pubmed/29075315 http://dx.doi.org/10.1186/s13017-017-0157-y Text en © The Author(s). 2017 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Review Poon, Samuel Ho Ting Lee, Jennifer Wah Yan NG, Ka Man Chiu, Gloria Wing Yan Wong, Brian Yung Kong Foo, Chi Chung Law, Wai Lun The current management of acute uncomplicated appendicitis: should there be a change in paradigm? A systematic review of the literatures and analysis of treatment performance |
title | The current management of acute uncomplicated appendicitis: should there be a change in paradigm? A systematic review of the literatures and analysis of treatment performance |
title_full | The current management of acute uncomplicated appendicitis: should there be a change in paradigm? A systematic review of the literatures and analysis of treatment performance |
title_fullStr | The current management of acute uncomplicated appendicitis: should there be a change in paradigm? A systematic review of the literatures and analysis of treatment performance |
title_full_unstemmed | The current management of acute uncomplicated appendicitis: should there be a change in paradigm? A systematic review of the literatures and analysis of treatment performance |
title_short | The current management of acute uncomplicated appendicitis: should there be a change in paradigm? A systematic review of the literatures and analysis of treatment performance |
title_sort | current management of acute uncomplicated appendicitis: should there be a change in paradigm? a systematic review of the literatures and analysis of treatment performance |
topic | Review |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5644137/ https://www.ncbi.nlm.nih.gov/pubmed/29075315 http://dx.doi.org/10.1186/s13017-017-0157-y |
work_keys_str_mv | AT poonsamuelhoting thecurrentmanagementofacuteuncomplicatedappendicitisshouldtherebeachangeinparadigmasystematicreviewoftheliteraturesandanalysisoftreatmentperformance AT leejenniferwahyan thecurrentmanagementofacuteuncomplicatedappendicitisshouldtherebeachangeinparadigmasystematicreviewoftheliteraturesandanalysisoftreatmentperformance AT ngkaman thecurrentmanagementofacuteuncomplicatedappendicitisshouldtherebeachangeinparadigmasystematicreviewoftheliteraturesandanalysisoftreatmentperformance AT chiugloriawingyan thecurrentmanagementofacuteuncomplicatedappendicitisshouldtherebeachangeinparadigmasystematicreviewoftheliteraturesandanalysisoftreatmentperformance AT wongbrianyungkong thecurrentmanagementofacuteuncomplicatedappendicitisshouldtherebeachangeinparadigmasystematicreviewoftheliteraturesandanalysisoftreatmentperformance AT foochichung thecurrentmanagementofacuteuncomplicatedappendicitisshouldtherebeachangeinparadigmasystematicreviewoftheliteraturesandanalysisoftreatmentperformance AT lawwailun thecurrentmanagementofacuteuncomplicatedappendicitisshouldtherebeachangeinparadigmasystematicreviewoftheliteraturesandanalysisoftreatmentperformance AT poonsamuelhoting currentmanagementofacuteuncomplicatedappendicitisshouldtherebeachangeinparadigmasystematicreviewoftheliteraturesandanalysisoftreatmentperformance AT leejenniferwahyan currentmanagementofacuteuncomplicatedappendicitisshouldtherebeachangeinparadigmasystematicreviewoftheliteraturesandanalysisoftreatmentperformance AT ngkaman currentmanagementofacuteuncomplicatedappendicitisshouldtherebeachangeinparadigmasystematicreviewoftheliteraturesandanalysisoftreatmentperformance AT chiugloriawingyan currentmanagementofacuteuncomplicatedappendicitisshouldtherebeachangeinparadigmasystematicreviewoftheliteraturesandanalysisoftreatmentperformance AT wongbrianyungkong currentmanagementofacuteuncomplicatedappendicitisshouldtherebeachangeinparadigmasystematicreviewoftheliteraturesandanalysisoftreatmentperformance AT foochichung currentmanagementofacuteuncomplicatedappendicitisshouldtherebeachangeinparadigmasystematicreviewoftheliteraturesandanalysisoftreatmentperformance AT lawwailun currentmanagementofacuteuncomplicatedappendicitisshouldtherebeachangeinparadigmasystematicreviewoftheliteraturesandanalysisoftreatmentperformance |