Cargando…

Epithelioid hemangioma of penis mimicking malignancy: A rare case

Penile epithelioid hemangioma (EH) is a rare vascular neoplasm with no definite etiology. Herein, we report a case of EH of the penis in a 64-year-old man presenting with painless, bleeding mass on the glans penis. The patient underwent local excision, and on histopathological examination, a diagnos...

Descripción completa

Detalles Bibliográficos
Autores principales: Kishore, Manjari, Bhardwaj, Minakshi, Ahuja, Arvind
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Medknow Publications & Media Pvt Ltd 2017
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5656971/
https://www.ncbi.nlm.nih.gov/pubmed/29118548
http://dx.doi.org/10.4103/UA.UA_40_17
_version_ 1783273798811779072
author Kishore, Manjari
Bhardwaj, Minakshi
Ahuja, Arvind
author_facet Kishore, Manjari
Bhardwaj, Minakshi
Ahuja, Arvind
author_sort Kishore, Manjari
collection PubMed
description Penile epithelioid hemangioma (EH) is a rare vascular neoplasm with no definite etiology. Herein, we report a case of EH of the penis in a 64-year-old man presenting with painless, bleeding mass on the glans penis. The patient underwent local excision, and on histopathological examination, a diagnosis of EH was made. Immunohistochemistry revealed positivity for CD31, smooth muscle antigen, and negative expression of cytokeratin. The present case highlights the importance of histopathology in conjunction with immunohistochemistry to reach a definitive diagnosis of this rare benign entity and differentiating it from the close malignant mimics, thereby avoiding aggressive management of the patients.
format Online
Article
Text
id pubmed-5656971
institution National Center for Biotechnology Information
language English
publishDate 2017
publisher Medknow Publications & Media Pvt Ltd
record_format MEDLINE/PubMed
spelling pubmed-56569712017-11-08 Epithelioid hemangioma of penis mimicking malignancy: A rare case Kishore, Manjari Bhardwaj, Minakshi Ahuja, Arvind Urol Ann Case Report Penile epithelioid hemangioma (EH) is a rare vascular neoplasm with no definite etiology. Herein, we report a case of EH of the penis in a 64-year-old man presenting with painless, bleeding mass on the glans penis. The patient underwent local excision, and on histopathological examination, a diagnosis of EH was made. Immunohistochemistry revealed positivity for CD31, smooth muscle antigen, and negative expression of cytokeratin. The present case highlights the importance of histopathology in conjunction with immunohistochemistry to reach a definitive diagnosis of this rare benign entity and differentiating it from the close malignant mimics, thereby avoiding aggressive management of the patients. Medknow Publications & Media Pvt Ltd 2017 /pmc/articles/PMC5656971/ /pubmed/29118548 http://dx.doi.org/10.4103/UA.UA_40_17 Text en Copyright: © 2017 Urology Annals http://creativecommons.org/licenses/by-nc-sa/3.0 This is an open access article distributed under the terms of the Creative Commons Attribution-NonCommercial-ShareAlike 3.0 License, which allows others to remix, tweak, and build upon the work non-commercially, as long as the author is credited and the new creations are licensed under the identical terms.
spellingShingle Case Report
Kishore, Manjari
Bhardwaj, Minakshi
Ahuja, Arvind
Epithelioid hemangioma of penis mimicking malignancy: A rare case
title Epithelioid hemangioma of penis mimicking malignancy: A rare case
title_full Epithelioid hemangioma of penis mimicking malignancy: A rare case
title_fullStr Epithelioid hemangioma of penis mimicking malignancy: A rare case
title_full_unstemmed Epithelioid hemangioma of penis mimicking malignancy: A rare case
title_short Epithelioid hemangioma of penis mimicking malignancy: A rare case
title_sort epithelioid hemangioma of penis mimicking malignancy: a rare case
topic Case Report
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5656971/
https://www.ncbi.nlm.nih.gov/pubmed/29118548
http://dx.doi.org/10.4103/UA.UA_40_17
work_keys_str_mv AT kishoremanjari epithelioidhemangiomaofpenismimickingmalignancyararecase
AT bhardwajminakshi epithelioidhemangiomaofpenismimickingmalignancyararecase
AT ahujaarvind epithelioidhemangiomaofpenismimickingmalignancyararecase