Cargando…
Epithelioid hemangioma of penis mimicking malignancy: A rare case
Penile epithelioid hemangioma (EH) is a rare vascular neoplasm with no definite etiology. Herein, we report a case of EH of the penis in a 64-year-old man presenting with painless, bleeding mass on the glans penis. The patient underwent local excision, and on histopathological examination, a diagnos...
Autores principales: | , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Medknow Publications & Media Pvt Ltd
2017
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5656971/ https://www.ncbi.nlm.nih.gov/pubmed/29118548 http://dx.doi.org/10.4103/UA.UA_40_17 |
_version_ | 1783273798811779072 |
---|---|
author | Kishore, Manjari Bhardwaj, Minakshi Ahuja, Arvind |
author_facet | Kishore, Manjari Bhardwaj, Minakshi Ahuja, Arvind |
author_sort | Kishore, Manjari |
collection | PubMed |
description | Penile epithelioid hemangioma (EH) is a rare vascular neoplasm with no definite etiology. Herein, we report a case of EH of the penis in a 64-year-old man presenting with painless, bleeding mass on the glans penis. The patient underwent local excision, and on histopathological examination, a diagnosis of EH was made. Immunohistochemistry revealed positivity for CD31, smooth muscle antigen, and negative expression of cytokeratin. The present case highlights the importance of histopathology in conjunction with immunohistochemistry to reach a definitive diagnosis of this rare benign entity and differentiating it from the close malignant mimics, thereby avoiding aggressive management of the patients. |
format | Online Article Text |
id | pubmed-5656971 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2017 |
publisher | Medknow Publications & Media Pvt Ltd |
record_format | MEDLINE/PubMed |
spelling | pubmed-56569712017-11-08 Epithelioid hemangioma of penis mimicking malignancy: A rare case Kishore, Manjari Bhardwaj, Minakshi Ahuja, Arvind Urol Ann Case Report Penile epithelioid hemangioma (EH) is a rare vascular neoplasm with no definite etiology. Herein, we report a case of EH of the penis in a 64-year-old man presenting with painless, bleeding mass on the glans penis. The patient underwent local excision, and on histopathological examination, a diagnosis of EH was made. Immunohistochemistry revealed positivity for CD31, smooth muscle antigen, and negative expression of cytokeratin. The present case highlights the importance of histopathology in conjunction with immunohistochemistry to reach a definitive diagnosis of this rare benign entity and differentiating it from the close malignant mimics, thereby avoiding aggressive management of the patients. Medknow Publications & Media Pvt Ltd 2017 /pmc/articles/PMC5656971/ /pubmed/29118548 http://dx.doi.org/10.4103/UA.UA_40_17 Text en Copyright: © 2017 Urology Annals http://creativecommons.org/licenses/by-nc-sa/3.0 This is an open access article distributed under the terms of the Creative Commons Attribution-NonCommercial-ShareAlike 3.0 License, which allows others to remix, tweak, and build upon the work non-commercially, as long as the author is credited and the new creations are licensed under the identical terms. |
spellingShingle | Case Report Kishore, Manjari Bhardwaj, Minakshi Ahuja, Arvind Epithelioid hemangioma of penis mimicking malignancy: A rare case |
title | Epithelioid hemangioma of penis mimicking malignancy: A rare case |
title_full | Epithelioid hemangioma of penis mimicking malignancy: A rare case |
title_fullStr | Epithelioid hemangioma of penis mimicking malignancy: A rare case |
title_full_unstemmed | Epithelioid hemangioma of penis mimicking malignancy: A rare case |
title_short | Epithelioid hemangioma of penis mimicking malignancy: A rare case |
title_sort | epithelioid hemangioma of penis mimicking malignancy: a rare case |
topic | Case Report |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5656971/ https://www.ncbi.nlm.nih.gov/pubmed/29118548 http://dx.doi.org/10.4103/UA.UA_40_17 |
work_keys_str_mv | AT kishoremanjari epithelioidhemangiomaofpenismimickingmalignancyararecase AT bhardwajminakshi epithelioidhemangiomaofpenismimickingmalignancyararecase AT ahujaarvind epithelioidhemangiomaofpenismimickingmalignancyararecase |