Recovery from Cogwheel Rigidity and Akinesia and Improvement in Vibration Sense and Olfactory Perception following Removal of an Epoxy-Oleic Acid DNA Adduct

The epoxy fatty acid cis-12,13-epoxy-oleic acid, which acts as a DNA adduct, may be generated during long-term storage of many seed oils, including those used in cooking, with frying oils and fried foods being a major source in the modern human diet. Removal of this epoxy fatty acid from the locus o...

Descripción completa

Detalles Bibliográficos
Autores principales: Monro, Jean A., McLaren-Howard, John, Shah, Mussadiq, Julu, Peter O. O., Puri, Basant K.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Hindawi 2017
Materias:
Case Report
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5664261/
https://www.ncbi.nlm.nih.gov/pubmed/29181030
http://dx.doi.org/10.1155/2017/3512353
_version_ 1783274962774130688
author Monro, Jean A.
McLaren-Howard, John
Shah, Mussadiq
Julu, Peter O. O.
Puri, Basant K.
author_facet Monro, Jean A.
McLaren-Howard, John
Shah, Mussadiq
Julu, Peter O. O.
Puri, Basant K.
author_sort Monro, Jean A.
collection PubMed
description The epoxy fatty acid cis-12,13-epoxy-oleic acid, which acts as a DNA adduct, may be generated during long-term storage of many seed oils, including those used in cooking, with frying oils and fried foods being a major source in the modern human diet. Removal of this epoxy fatty acid from the locus of the N-formyl peptide receptors was associated with recovery from cogwheel rigidity and akinesia as well as with improvement in vibration sense and olfactory perception.
format Online
Article
Text
id pubmed-5664261
institution National Center for Biotechnology Information
language English
publishDate 2017
publisher Hindawi
record_format MEDLINE/PubMed
spelling pubmed-56642612017-11-27 Recovery from Cogwheel Rigidity and Akinesia and Improvement in Vibration Sense and Olfactory Perception following Removal of an Epoxy-Oleic Acid DNA Adduct Monro, Jean A. McLaren-Howard, John Shah, Mussadiq Julu, Peter O. O. Puri, Basant K. Case Rep Med Case Report The epoxy fatty acid cis-12,13-epoxy-oleic acid, which acts as a DNA adduct, may be generated during long-term storage of many seed oils, including those used in cooking, with frying oils and fried foods being a major source in the modern human diet. Removal of this epoxy fatty acid from the locus of the N-formyl peptide receptors was associated with recovery from cogwheel rigidity and akinesia as well as with improvement in vibration sense and olfactory perception. Hindawi 2017 2017-10-18 /pmc/articles/PMC5664261/ /pubmed/29181030 http://dx.doi.org/10.1155/2017/3512353 Text en Copyright © 2017 Jean A. Monro et al. https://creativecommons.org/licenses/by/4.0/ This is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.
spellingShingle Case Report
Monro, Jean A.
McLaren-Howard, John
Shah, Mussadiq
Julu, Peter O. O.
Puri, Basant K.
Recovery from Cogwheel Rigidity and Akinesia and Improvement in Vibration Sense and Olfactory Perception following Removal of an Epoxy-Oleic Acid DNA Adduct
title Recovery from Cogwheel Rigidity and Akinesia and Improvement in Vibration Sense and Olfactory Perception following Removal of an Epoxy-Oleic Acid DNA Adduct
title_full Recovery from Cogwheel Rigidity and Akinesia and Improvement in Vibration Sense and Olfactory Perception following Removal of an Epoxy-Oleic Acid DNA Adduct
title_fullStr Recovery from Cogwheel Rigidity and Akinesia and Improvement in Vibration Sense and Olfactory Perception following Removal of an Epoxy-Oleic Acid DNA Adduct
title_full_unstemmed Recovery from Cogwheel Rigidity and Akinesia and Improvement in Vibration Sense and Olfactory Perception following Removal of an Epoxy-Oleic Acid DNA Adduct
title_short Recovery from Cogwheel Rigidity and Akinesia and Improvement in Vibration Sense and Olfactory Perception following Removal of an Epoxy-Oleic Acid DNA Adduct
title_sort recovery from cogwheel rigidity and akinesia and improvement in vibration sense and olfactory perception following removal of an epoxy-oleic acid dna adduct
topic Case Report
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5664261/
https://www.ncbi.nlm.nih.gov/pubmed/29181030
http://dx.doi.org/10.1155/2017/3512353
work_keys_str_mv AT monrojeana recoveryfromcogwheelrigidityandakinesiaandimprovementinvibrationsenseandolfactoryperceptionfollowingremovalofanepoxyoleicaciddnaadduct
AT mclarenhowardjohn recoveryfromcogwheelrigidityandakinesiaandimprovementinvibrationsenseandolfactoryperceptionfollowingremovalofanepoxyoleicaciddnaadduct
AT shahmussadiq recoveryfromcogwheelrigidityandakinesiaandimprovementinvibrationsenseandolfactoryperceptionfollowingremovalofanepoxyoleicaciddnaadduct
AT julupeteroo recoveryfromcogwheelrigidityandakinesiaandimprovementinvibrationsenseandolfactoryperceptionfollowingremovalofanepoxyoleicaciddnaadduct
AT puribasantk recoveryfromcogwheelrigidityandakinesiaandimprovementinvibrationsenseandolfactoryperceptionfollowingremovalofanepoxyoleicaciddnaadduct

Ejemplares similares