The MAPKKK gene family in cassava: Genome-wide identification and expression analysis against drought stress

Mitogen-activated protein kinase kinase kinases (MAPKKKs), an important unit of MAPK cascade, play crucial roles in plant development and response to various stresses. However, little is known concerning the MAPKKK family in the important subtropical and tropical crop cassava. In this study, 62 MAPK...

Descripción completa

Detalles Bibliográficos
Autores principales: Ye, Jianqiu, Yang, Hai, Shi, Haitao, Wei, Yunxie, Tie, Weiwei, Ding, Zehong, Yan, Yan, Luo, Ying, Xia, Zhiqiang, Wang, Wenquan, Peng, Ming, Li, Kaimian, Zhang, He, Hu, Wei
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Nature Publishing Group UK 2017
Materias:
Article
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5668296/
https://www.ncbi.nlm.nih.gov/pubmed/29097722
http://dx.doi.org/10.1038/s41598-017-13988-8
_version_ 1783275643118551040
author Ye, Jianqiu
Yang, Hai
Shi, Haitao
Wei, Yunxie
Tie, Weiwei
Ding, Zehong
Yan, Yan
Luo, Ying
Xia, Zhiqiang
Wang, Wenquan
Peng, Ming
Li, Kaimian
Zhang, He
Hu, Wei
author_facet Ye, Jianqiu
Yang, Hai
Shi, Haitao
Wei, Yunxie
Tie, Weiwei
Ding, Zehong
Yan, Yan
Luo, Ying
Xia, Zhiqiang
Wang, Wenquan
Peng, Ming
Li, Kaimian
Zhang, He
Hu, Wei
author_sort Ye, Jianqiu
collection PubMed
description Mitogen-activated protein kinase kinase kinases (MAPKKKs), an important unit of MAPK cascade, play crucial roles in plant development and response to various stresses. However, little is known concerning the MAPKKK family in the important subtropical and tropical crop cassava. In this study, 62 MAPKKK genes were identified in the cassava genome, and were classified into 3 subfamilies based on phylogenetic analysis. Most of MAPKKKs in the same subfamily shared similar gene structures and conserved motifs. The comprehensive transcriptome analysis showed that MAPKKK genes participated in tissue development and response to drought stress. Comparative expression profiles revealed that many MAPKKK genes were activated in cultivated varieties SC124 and Arg7 and the function of MeMAPKKKs in drought resistance may be different between SC124/Arg7 and W14. Expression analyses of the 7 selected MeMAPKKK genes showed that most of them were significantly upregulated by osmotic, salt and ABA treatments, whereas slightly induced by H(2)O(2) and cold stresses. Taken together, this study identified candidate MeMAPKKK genes for genetic improvement of abiotic stress resistance and provided new insights into MAPKKK -mediated cassava resistance to drought stress.
format Online
Article
Text
id pubmed-5668296
institution National Center for Biotechnology Information
language English
publishDate 2017
publisher Nature Publishing Group UK
record_format MEDLINE/PubMed
spelling pubmed-56682962017-11-08 The MAPKKK gene family in cassava: Genome-wide identification and expression analysis against drought stress Ye, Jianqiu Yang, Hai Shi, Haitao Wei, Yunxie Tie, Weiwei Ding, Zehong Yan, Yan Luo, Ying Xia, Zhiqiang Wang, Wenquan Peng, Ming Li, Kaimian Zhang, He Hu, Wei Sci Rep Article Mitogen-activated protein kinase kinase kinases (MAPKKKs), an important unit of MAPK cascade, play crucial roles in plant development and response to various stresses. However, little is known concerning the MAPKKK family in the important subtropical and tropical crop cassava. In this study, 62 MAPKKK genes were identified in the cassava genome, and were classified into 3 subfamilies based on phylogenetic analysis. Most of MAPKKKs in the same subfamily shared similar gene structures and conserved motifs. The comprehensive transcriptome analysis showed that MAPKKK genes participated in tissue development and response to drought stress. Comparative expression profiles revealed that many MAPKKK genes were activated in cultivated varieties SC124 and Arg7 and the function of MeMAPKKKs in drought resistance may be different between SC124/Arg7 and W14. Expression analyses of the 7 selected MeMAPKKK genes showed that most of them were significantly upregulated by osmotic, salt and ABA treatments, whereas slightly induced by H(2)O(2) and cold stresses. Taken together, this study identified candidate MeMAPKKK genes for genetic improvement of abiotic stress resistance and provided new insights into MAPKKK -mediated cassava resistance to drought stress. Nature Publishing Group UK 2017-11-02 /pmc/articles/PMC5668296/ /pubmed/29097722 http://dx.doi.org/10.1038/s41598-017-13988-8 Text en © The Author(s) 2017 Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The images or other third party material in this article are included in the article’s Creative Commons license, unless indicated otherwise in a credit line to the material. If material is not included in the article’s Creative Commons license and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this license, visit http://creativecommons.org/licenses/by/4.0/.
spellingShingle Article
Ye, Jianqiu
Yang, Hai
Shi, Haitao
Wei, Yunxie
Tie, Weiwei
Ding, Zehong
Yan, Yan
Luo, Ying
Xia, Zhiqiang
Wang, Wenquan
Peng, Ming
Li, Kaimian
Zhang, He
Hu, Wei
The MAPKKK gene family in cassava: Genome-wide identification and expression analysis against drought stress
title The MAPKKK gene family in cassava: Genome-wide identification and expression analysis against drought stress
title_full The MAPKKK gene family in cassava: Genome-wide identification and expression analysis against drought stress
title_fullStr The MAPKKK gene family in cassava: Genome-wide identification and expression analysis against drought stress
title_full_unstemmed The MAPKKK gene family in cassava: Genome-wide identification and expression analysis against drought stress
title_short The MAPKKK gene family in cassava: Genome-wide identification and expression analysis against drought stress
title_sort mapkkk gene family in cassava: genome-wide identification and expression analysis against drought stress
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5668296/
https://www.ncbi.nlm.nih.gov/pubmed/29097722
http://dx.doi.org/10.1038/s41598-017-13988-8
work_keys_str_mv AT yejianqiu themapkkkgenefamilyincassavagenomewideidentificationandexpressionanalysisagainstdroughtstress
AT yanghai themapkkkgenefamilyincassavagenomewideidentificationandexpressionanalysisagainstdroughtstress
AT shihaitao themapkkkgenefamilyincassavagenomewideidentificationandexpressionanalysisagainstdroughtstress
AT weiyunxie themapkkkgenefamilyincassavagenomewideidentificationandexpressionanalysisagainstdroughtstress
AT tieweiwei themapkkkgenefamilyincassavagenomewideidentificationandexpressionanalysisagainstdroughtstress
AT dingzehong themapkkkgenefamilyincassavagenomewideidentificationandexpressionanalysisagainstdroughtstress
AT yanyan themapkkkgenefamilyincassavagenomewideidentificationandexpressionanalysisagainstdroughtstress
AT luoying themapkkkgenefamilyincassavagenomewideidentificationandexpressionanalysisagainstdroughtstress
AT xiazhiqiang themapkkkgenefamilyincassavagenomewideidentificationandexpressionanalysisagainstdroughtstress
AT wangwenquan themapkkkgenefamilyincassavagenomewideidentificationandexpressionanalysisagainstdroughtstress
AT pengming themapkkkgenefamilyincassavagenomewideidentificationandexpressionanalysisagainstdroughtstress
AT likaimian themapkkkgenefamilyincassavagenomewideidentificationandexpressionanalysisagainstdroughtstress
AT zhanghe themapkkkgenefamilyincassavagenomewideidentificationandexpressionanalysisagainstdroughtstress
AT huwei themapkkkgenefamilyincassavagenomewideidentificationandexpressionanalysisagainstdroughtstress
AT yejianqiu mapkkkgenefamilyincassavagenomewideidentificationandexpressionanalysisagainstdroughtstress
AT yanghai mapkkkgenefamilyincassavagenomewideidentificationandexpressionanalysisagainstdroughtstress
AT shihaitao mapkkkgenefamilyincassavagenomewideidentificationandexpressionanalysisagainstdroughtstress
AT weiyunxie mapkkkgenefamilyincassavagenomewideidentificationandexpressionanalysisagainstdroughtstress
AT tieweiwei mapkkkgenefamilyincassavagenomewideidentificationandexpressionanalysisagainstdroughtstress
AT dingzehong mapkkkgenefamilyincassavagenomewideidentificationandexpressionanalysisagainstdroughtstress
AT yanyan mapkkkgenefamilyincassavagenomewideidentificationandexpressionanalysisagainstdroughtstress
AT luoying mapkkkgenefamilyincassavagenomewideidentificationandexpressionanalysisagainstdroughtstress
AT xiazhiqiang mapkkkgenefamilyincassavagenomewideidentificationandexpressionanalysisagainstdroughtstress
AT wangwenquan mapkkkgenefamilyincassavagenomewideidentificationandexpressionanalysisagainstdroughtstress
AT pengming mapkkkgenefamilyincassavagenomewideidentificationandexpressionanalysisagainstdroughtstress
AT likaimian mapkkkgenefamilyincassavagenomewideidentificationandexpressionanalysisagainstdroughtstress
AT zhanghe mapkkkgenefamilyincassavagenomewideidentificationandexpressionanalysisagainstdroughtstress
AT huwei mapkkkgenefamilyincassavagenomewideidentificationandexpressionanalysisagainstdroughtstress

Ejemplares similares