Cargando…
Varicella zoster virus-associated morbidity and mortality in Africa – a systematic review
BACKGROUND: Varicella zoster virus (VZV) causes varicella and herpes zoster. These vaccine preventable diseases are common globally. Most available data on VZV epidemiology are from industrialised temperate countries and cannot be used to guide decisions on the immunization policy against VZV in Afr...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2017
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5686819/ https://www.ncbi.nlm.nih.gov/pubmed/29137604 http://dx.doi.org/10.1186/s12879-017-2815-9 |
_version_ | 1783278841689538560 |
---|---|
author | Hussey, Hannah Abdullahi, Leila Collins, Jamie Muloiwa, Rudzani Hussey, Gregory Kagina, Benjamin |
author_facet | Hussey, Hannah Abdullahi, Leila Collins, Jamie Muloiwa, Rudzani Hussey, Gregory Kagina, Benjamin |
author_sort | Hussey, Hannah |
collection | PubMed |
description | BACKGROUND: Varicella zoster virus (VZV) causes varicella and herpes zoster. These vaccine preventable diseases are common globally. Most available data on VZV epidemiology are from industrialised temperate countries and cannot be used to guide decisions on the immunization policy against VZV in Africa. This systematic review aims to review the published data on VZV morbidity and mortality in Africa. METHODS: All published studies conducted in Africa from 1974 to 2015 were eligible. Eligible studies must have reported any VZV epidemiological measure (incidence, prevalence, hospitalization rate and mortality rate). For inclusion in the review, studies must have used a defined VZV case definition, be it clinical or laboratory-based. RESULTS: Twenty articles from 13 African countries were included in the review. Most included studies were cross-sectional, conducted on hospitalized patients, and half of the studies used varying serological methods for diagnosis. VZV seroprevalence was very high among adults. Limited data on VZV seroprevalence in children showed very low seropositivity to anti-VZV antibodies. Co-morbidity with VZV was common. CONCLUSION: There is lack of quality data that could be used to develop VZV control programmes, including vaccination, in Africa. TRIAL REGISTRATION: PROSPERO 2015: CRD42015026144. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s12879-017-2815-9) contains supplementary material, which is available to authorized users. |
format | Online Article Text |
id | pubmed-5686819 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2017 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-56868192017-11-21 Varicella zoster virus-associated morbidity and mortality in Africa – a systematic review Hussey, Hannah Abdullahi, Leila Collins, Jamie Muloiwa, Rudzani Hussey, Gregory Kagina, Benjamin BMC Infect Dis Research Article BACKGROUND: Varicella zoster virus (VZV) causes varicella and herpes zoster. These vaccine preventable diseases are common globally. Most available data on VZV epidemiology are from industrialised temperate countries and cannot be used to guide decisions on the immunization policy against VZV in Africa. This systematic review aims to review the published data on VZV morbidity and mortality in Africa. METHODS: All published studies conducted in Africa from 1974 to 2015 were eligible. Eligible studies must have reported any VZV epidemiological measure (incidence, prevalence, hospitalization rate and mortality rate). For inclusion in the review, studies must have used a defined VZV case definition, be it clinical or laboratory-based. RESULTS: Twenty articles from 13 African countries were included in the review. Most included studies were cross-sectional, conducted on hospitalized patients, and half of the studies used varying serological methods for diagnosis. VZV seroprevalence was very high among adults. Limited data on VZV seroprevalence in children showed very low seropositivity to anti-VZV antibodies. Co-morbidity with VZV was common. CONCLUSION: There is lack of quality data that could be used to develop VZV control programmes, including vaccination, in Africa. TRIAL REGISTRATION: PROSPERO 2015: CRD42015026144. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s12879-017-2815-9) contains supplementary material, which is available to authorized users. BioMed Central 2017-11-14 /pmc/articles/PMC5686819/ /pubmed/29137604 http://dx.doi.org/10.1186/s12879-017-2815-9 Text en © The Author(s). 2017 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Article Hussey, Hannah Abdullahi, Leila Collins, Jamie Muloiwa, Rudzani Hussey, Gregory Kagina, Benjamin Varicella zoster virus-associated morbidity and mortality in Africa – a systematic review |
title | Varicella zoster virus-associated morbidity and mortality in Africa – a systematic review |
title_full | Varicella zoster virus-associated morbidity and mortality in Africa – a systematic review |
title_fullStr | Varicella zoster virus-associated morbidity and mortality in Africa – a systematic review |
title_full_unstemmed | Varicella zoster virus-associated morbidity and mortality in Africa – a systematic review |
title_short | Varicella zoster virus-associated morbidity and mortality in Africa – a systematic review |
title_sort | varicella zoster virus-associated morbidity and mortality in africa – a systematic review |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5686819/ https://www.ncbi.nlm.nih.gov/pubmed/29137604 http://dx.doi.org/10.1186/s12879-017-2815-9 |
work_keys_str_mv | AT husseyhannah varicellazostervirusassociatedmorbidityandmortalityinafricaasystematicreview AT abdullahileila varicellazostervirusassociatedmorbidityandmortalityinafricaasystematicreview AT collinsjamie varicellazostervirusassociatedmorbidityandmortalityinafricaasystematicreview AT muloiwarudzani varicellazostervirusassociatedmorbidityandmortalityinafricaasystematicreview AT husseygregory varicellazostervirusassociatedmorbidityandmortalityinafricaasystematicreview AT kaginabenjamin varicellazostervirusassociatedmorbidityandmortalityinafricaasystematicreview |