Cargando…
A qualitative exploration of perceptions and experiences of contraceptive use, abortion and post-abortion family planning services (PAFP) in three provinces in China
BACKGROUND: The INPAC project aims to evaluate the effectiveness of integrated post-abortion family planning (PAFP) services into existing hospital based abortion services in China. A qualitative study was conducted in three provinces to contribute to developing effective PAFP services through under...
Autores principales: | , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2017
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5697166/ https://www.ncbi.nlm.nih.gov/pubmed/29157259 http://dx.doi.org/10.1186/s12905-017-0458-z |
_version_ | 1783280555567087616 |
---|---|
author | Che, Yan Dusabe-Richards, Esther Wu, Shangchun Jiang, Yi Dong, Xiaojing Li, Jian Zhang, Wei-Hong Temmerman, Marleen Tolhurst, Rachel |
author_facet | Che, Yan Dusabe-Richards, Esther Wu, Shangchun Jiang, Yi Dong, Xiaojing Li, Jian Zhang, Wei-Hong Temmerman, Marleen Tolhurst, Rachel |
author_sort | Che, Yan |
collection | PubMed |
description | BACKGROUND: The INPAC project aims to evaluate the effectiveness of integrated post-abortion family planning (PAFP) services into existing hospital based abortion services in China. A qualitative study was conducted in three provinces to contribute to developing effective PAFP services through understanding influences on contraceptive use, experiences of abortion and existing PAFP, and their effect on future contraceptive practices from the perspective of users, in the context of social and institutional change. METHODS: Twenty-nine in-depth interviews (IDIs) were undertaken with women who had experienced abortion between 1 and 6 months prior to interview, recruited from three urban and two rural facilities in each province. Thirteen IDIs were also conducted with male partners. Six focus group discussions (FGDs) were carried out with community members from different social groups, including unmarried and married women and men, urban residents and rural-to-urban migrants. RESULTS: Social networks and norms are important in shaping attitudes and behaviour towards abortion and contraception. Widespread concerns were expressed about side-effects, reliability and effects on future fertility of some modern contraceptives. The combination of limited information and choices and a lack of person-centred counselling in PAFP with anxieties about side effects underlies the widespread use of unreliable methods. Gendered power relations significantly influence contraceptive (non)use, with several examples illustrating women’s relative lack of power to decide on a method, particularly in the case of condoms. Although the availability of contraceptive information from respected providers can offer impetus for individual behaviour change, social distance from providers reduces opportunities for clients to discuss their difficulties regarding contraceptive use; particularly, but not exclusively for young, unmarried clients. CONCLUSIONS: Increased access to non-commercial, reliable information on contraceptive methods is needed. PAFP services must go beyond simple information provision to ensure that providers take a more person-centred approach, which considers the most appropriate method for individual clients and probes for the underlying influences on contraceptive (non)use. More sensitive reflection on gender norms and relationships is required during counselling and, where women choose this, efforts should be made to include their male partners. Specific attention to provider positionality and skills for counselling young, unmarried clients is needed. |
format | Online Article Text |
id | pubmed-5697166 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2017 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-56971662017-12-01 A qualitative exploration of perceptions and experiences of contraceptive use, abortion and post-abortion family planning services (PAFP) in three provinces in China Che, Yan Dusabe-Richards, Esther Wu, Shangchun Jiang, Yi Dong, Xiaojing Li, Jian Zhang, Wei-Hong Temmerman, Marleen Tolhurst, Rachel BMC Womens Health Research Article BACKGROUND: The INPAC project aims to evaluate the effectiveness of integrated post-abortion family planning (PAFP) services into existing hospital based abortion services in China. A qualitative study was conducted in three provinces to contribute to developing effective PAFP services through understanding influences on contraceptive use, experiences of abortion and existing PAFP, and their effect on future contraceptive practices from the perspective of users, in the context of social and institutional change. METHODS: Twenty-nine in-depth interviews (IDIs) were undertaken with women who had experienced abortion between 1 and 6 months prior to interview, recruited from three urban and two rural facilities in each province. Thirteen IDIs were also conducted with male partners. Six focus group discussions (FGDs) were carried out with community members from different social groups, including unmarried and married women and men, urban residents and rural-to-urban migrants. RESULTS: Social networks and norms are important in shaping attitudes and behaviour towards abortion and contraception. Widespread concerns were expressed about side-effects, reliability and effects on future fertility of some modern contraceptives. The combination of limited information and choices and a lack of person-centred counselling in PAFP with anxieties about side effects underlies the widespread use of unreliable methods. Gendered power relations significantly influence contraceptive (non)use, with several examples illustrating women’s relative lack of power to decide on a method, particularly in the case of condoms. Although the availability of contraceptive information from respected providers can offer impetus for individual behaviour change, social distance from providers reduces opportunities for clients to discuss their difficulties regarding contraceptive use; particularly, but not exclusively for young, unmarried clients. CONCLUSIONS: Increased access to non-commercial, reliable information on contraceptive methods is needed. PAFP services must go beyond simple information provision to ensure that providers take a more person-centred approach, which considers the most appropriate method for individual clients and probes for the underlying influences on contraceptive (non)use. More sensitive reflection on gender norms and relationships is required during counselling and, where women choose this, efforts should be made to include their male partners. Specific attention to provider positionality and skills for counselling young, unmarried clients is needed. BioMed Central 2017-11-21 /pmc/articles/PMC5697166/ /pubmed/29157259 http://dx.doi.org/10.1186/s12905-017-0458-z Text en © The Author(s). 2017 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Article Che, Yan Dusabe-Richards, Esther Wu, Shangchun Jiang, Yi Dong, Xiaojing Li, Jian Zhang, Wei-Hong Temmerman, Marleen Tolhurst, Rachel A qualitative exploration of perceptions and experiences of contraceptive use, abortion and post-abortion family planning services (PAFP) in three provinces in China |
title | A qualitative exploration of perceptions and experiences of contraceptive use, abortion and post-abortion family planning services (PAFP) in three provinces in China |
title_full | A qualitative exploration of perceptions and experiences of contraceptive use, abortion and post-abortion family planning services (PAFP) in three provinces in China |
title_fullStr | A qualitative exploration of perceptions and experiences of contraceptive use, abortion and post-abortion family planning services (PAFP) in three provinces in China |
title_full_unstemmed | A qualitative exploration of perceptions and experiences of contraceptive use, abortion and post-abortion family planning services (PAFP) in three provinces in China |
title_short | A qualitative exploration of perceptions and experiences of contraceptive use, abortion and post-abortion family planning services (PAFP) in three provinces in China |
title_sort | qualitative exploration of perceptions and experiences of contraceptive use, abortion and post-abortion family planning services (pafp) in three provinces in china |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5697166/ https://www.ncbi.nlm.nih.gov/pubmed/29157259 http://dx.doi.org/10.1186/s12905-017-0458-z |
work_keys_str_mv | AT cheyan aqualitativeexplorationofperceptionsandexperiencesofcontraceptiveuseabortionandpostabortionfamilyplanningservicespafpinthreeprovincesinchina AT dusaberichardsesther aqualitativeexplorationofperceptionsandexperiencesofcontraceptiveuseabortionandpostabortionfamilyplanningservicespafpinthreeprovincesinchina AT wushangchun aqualitativeexplorationofperceptionsandexperiencesofcontraceptiveuseabortionandpostabortionfamilyplanningservicespafpinthreeprovincesinchina AT jiangyi aqualitativeexplorationofperceptionsandexperiencesofcontraceptiveuseabortionandpostabortionfamilyplanningservicespafpinthreeprovincesinchina AT dongxiaojing aqualitativeexplorationofperceptionsandexperiencesofcontraceptiveuseabortionandpostabortionfamilyplanningservicespafpinthreeprovincesinchina AT lijian aqualitativeexplorationofperceptionsandexperiencesofcontraceptiveuseabortionandpostabortionfamilyplanningservicespafpinthreeprovincesinchina AT zhangweihong aqualitativeexplorationofperceptionsandexperiencesofcontraceptiveuseabortionandpostabortionfamilyplanningservicespafpinthreeprovincesinchina AT temmermanmarleen aqualitativeexplorationofperceptionsandexperiencesofcontraceptiveuseabortionandpostabortionfamilyplanningservicespafpinthreeprovincesinchina AT tolhurstrachel aqualitativeexplorationofperceptionsandexperiencesofcontraceptiveuseabortionandpostabortionfamilyplanningservicespafpinthreeprovincesinchina AT aqualitativeexplorationofperceptionsandexperiencesofcontraceptiveuseabortionandpostabortionfamilyplanningservicespafpinthreeprovincesinchina AT cheyan qualitativeexplorationofperceptionsandexperiencesofcontraceptiveuseabortionandpostabortionfamilyplanningservicespafpinthreeprovincesinchina AT dusaberichardsesther qualitativeexplorationofperceptionsandexperiencesofcontraceptiveuseabortionandpostabortionfamilyplanningservicespafpinthreeprovincesinchina AT wushangchun qualitativeexplorationofperceptionsandexperiencesofcontraceptiveuseabortionandpostabortionfamilyplanningservicespafpinthreeprovincesinchina AT jiangyi qualitativeexplorationofperceptionsandexperiencesofcontraceptiveuseabortionandpostabortionfamilyplanningservicespafpinthreeprovincesinchina AT dongxiaojing qualitativeexplorationofperceptionsandexperiencesofcontraceptiveuseabortionandpostabortionfamilyplanningservicespafpinthreeprovincesinchina AT lijian qualitativeexplorationofperceptionsandexperiencesofcontraceptiveuseabortionandpostabortionfamilyplanningservicespafpinthreeprovincesinchina AT zhangweihong qualitativeexplorationofperceptionsandexperiencesofcontraceptiveuseabortionandpostabortionfamilyplanningservicespafpinthreeprovincesinchina AT temmermanmarleen qualitativeexplorationofperceptionsandexperiencesofcontraceptiveuseabortionandpostabortionfamilyplanningservicespafpinthreeprovincesinchina AT tolhurstrachel qualitativeexplorationofperceptionsandexperiencesofcontraceptiveuseabortionandpostabortionfamilyplanningservicespafpinthreeprovincesinchina AT qualitativeexplorationofperceptionsandexperiencesofcontraceptiveuseabortionandpostabortionfamilyplanningservicespafpinthreeprovincesinchina |