Cargando…

Rapid changes in Atlantic grey seal milk from birth to weaning – immune factors and indicators of metabolic strain

True seals have the shortest lactation periods of any group of placental mammal. Most are capital breeders that undergo short, intense lactations, during which they fast while transferring substantial proportions of their body reserves to their pups, which they then abruptly wean. Milk was collected...

Descripción completa

Detalles Bibliográficos
Autores principales: Lowe, Amanda D., Bawazeer, Sami, Watson, David G., McGill, Suzanne, Burchmore, Richard J. S., Pomeroy, P. P (Paddy), Kennedy, Malcolm W.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Nature Publishing Group UK 2017
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5700954/
https://www.ncbi.nlm.nih.gov/pubmed/29170469
http://dx.doi.org/10.1038/s41598-017-16187-7
_version_ 1783281227221958656
author Lowe, Amanda D.
Bawazeer, Sami
Watson, David G.
McGill, Suzanne
Burchmore, Richard J. S.
Pomeroy, P. P (Paddy)
Kennedy, Malcolm W.
author_facet Lowe, Amanda D.
Bawazeer, Sami
Watson, David G.
McGill, Suzanne
Burchmore, Richard J. S.
Pomeroy, P. P (Paddy)
Kennedy, Malcolm W.
author_sort Lowe, Amanda D.
collection PubMed
description True seals have the shortest lactation periods of any group of placental mammal. Most are capital breeders that undergo short, intense lactations, during which they fast while transferring substantial proportions of their body reserves to their pups, which they then abruptly wean. Milk was collected from Atlantic grey seals (Halichoerus grypus) periodically from birth until near weaning. Milk protein profiles matured within 24 hours or less, indicating the most rapid transition from colostrum to mature phase lactation yet observed. There was an unexpected persistence of immunoglobulin G almost until weaning, potentially indicating prolonged trans-intestinal transfer of IgG. Among components of innate immune protection were found fucosyllactose and siallylactose that are thought to impede colonisation by pathogens and encourage an appropriate milk-digestive and protective gut microbiome. These oligosaccharides decreased from early lactation to almost undetectable levels by weaning. Taurine levels were initially high, then fell, possibly indicative of taurine dependency in seals, and progressive depletion of maternal reserves. Metabolites that signal changes in the mother’s metabolism of fats, such as nicotinamide and derivatives, rose from virtual absence, and acetylcarnitines fell. It is therefore possible that indicators of maternal metabolic strain exist that signal the imminence of weaning.
format Online
Article
Text
id pubmed-5700954
institution National Center for Biotechnology Information
language English
publishDate 2017
publisher Nature Publishing Group UK
record_format MEDLINE/PubMed
spelling pubmed-57009542017-11-30 Rapid changes in Atlantic grey seal milk from birth to weaning – immune factors and indicators of metabolic strain Lowe, Amanda D. Bawazeer, Sami Watson, David G. McGill, Suzanne Burchmore, Richard J. S. Pomeroy, P. P (Paddy) Kennedy, Malcolm W. Sci Rep Article True seals have the shortest lactation periods of any group of placental mammal. Most are capital breeders that undergo short, intense lactations, during which they fast while transferring substantial proportions of their body reserves to their pups, which they then abruptly wean. Milk was collected from Atlantic grey seals (Halichoerus grypus) periodically from birth until near weaning. Milk protein profiles matured within 24 hours or less, indicating the most rapid transition from colostrum to mature phase lactation yet observed. There was an unexpected persistence of immunoglobulin G almost until weaning, potentially indicating prolonged trans-intestinal transfer of IgG. Among components of innate immune protection were found fucosyllactose and siallylactose that are thought to impede colonisation by pathogens and encourage an appropriate milk-digestive and protective gut microbiome. These oligosaccharides decreased from early lactation to almost undetectable levels by weaning. Taurine levels were initially high, then fell, possibly indicative of taurine dependency in seals, and progressive depletion of maternal reserves. Metabolites that signal changes in the mother’s metabolism of fats, such as nicotinamide and derivatives, rose from virtual absence, and acetylcarnitines fell. It is therefore possible that indicators of maternal metabolic strain exist that signal the imminence of weaning. Nature Publishing Group UK 2017-11-23 /pmc/articles/PMC5700954/ /pubmed/29170469 http://dx.doi.org/10.1038/s41598-017-16187-7 Text en © The Author(s) 2017 Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The images or other third party material in this article are included in the article’s Creative Commons license, unless indicated otherwise in a credit line to the material. If material is not included in the article’s Creative Commons license and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this license, visit http://creativecommons.org/licenses/by/4.0/.
spellingShingle Article
Lowe, Amanda D.
Bawazeer, Sami
Watson, David G.
McGill, Suzanne
Burchmore, Richard J. S.
Pomeroy, P. P (Paddy)
Kennedy, Malcolm W.
Rapid changes in Atlantic grey seal milk from birth to weaning – immune factors and indicators of metabolic strain
title Rapid changes in Atlantic grey seal milk from birth to weaning – immune factors and indicators of metabolic strain
title_full Rapid changes in Atlantic grey seal milk from birth to weaning – immune factors and indicators of metabolic strain
title_fullStr Rapid changes in Atlantic grey seal milk from birth to weaning – immune factors and indicators of metabolic strain
title_full_unstemmed Rapid changes in Atlantic grey seal milk from birth to weaning – immune factors and indicators of metabolic strain
title_short Rapid changes in Atlantic grey seal milk from birth to weaning – immune factors and indicators of metabolic strain
title_sort rapid changes in atlantic grey seal milk from birth to weaning – immune factors and indicators of metabolic strain
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5700954/
https://www.ncbi.nlm.nih.gov/pubmed/29170469
http://dx.doi.org/10.1038/s41598-017-16187-7
work_keys_str_mv AT loweamandad rapidchangesinatlanticgreysealmilkfrombirthtoweaningimmunefactorsandindicatorsofmetabolicstrain
AT bawazeersami rapidchangesinatlanticgreysealmilkfrombirthtoweaningimmunefactorsandindicatorsofmetabolicstrain
AT watsondavidg rapidchangesinatlanticgreysealmilkfrombirthtoweaningimmunefactorsandindicatorsofmetabolicstrain
AT mcgillsuzanne rapidchangesinatlanticgreysealmilkfrombirthtoweaningimmunefactorsandindicatorsofmetabolicstrain
AT burchmorerichardjs rapidchangesinatlanticgreysealmilkfrombirthtoweaningimmunefactorsandindicatorsofmetabolicstrain
AT pomeroypppaddy rapidchangesinatlanticgreysealmilkfrombirthtoweaningimmunefactorsandindicatorsofmetabolicstrain
AT kennedymalcolmw rapidchangesinatlanticgreysealmilkfrombirthtoweaningimmunefactorsandindicatorsofmetabolicstrain