Cargando…
Unpublished systematic reviews and financial support: a meta-epidemiological study
OBJECTIVE: PROSPERO, an international prospective register of systematic reviews, was launched in February 2011 to reduce publication bias of systematic reviews (SRs). A questionnaire survey of SR researchers conducted in 2005 indicated the existence of unpublished SRs and the potential influence of...
Autores principales: | , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2017
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5717810/ https://www.ncbi.nlm.nih.gov/pubmed/29208054 http://dx.doi.org/10.1186/s13104-017-3043-5 |
_version_ | 1783284213393391616 |
---|---|
author | Tsujimoto, Hiraku Tsujimoto, Yasushi Kataoka, Yuki |
author_facet | Tsujimoto, Hiraku Tsujimoto, Yasushi Kataoka, Yuki |
author_sort | Tsujimoto, Hiraku |
collection | PubMed |
description | OBJECTIVE: PROSPERO, an international prospective register of systematic reviews, was launched in February 2011 to reduce publication bias of systematic reviews (SRs). A questionnaire survey of SR researchers conducted in 2005 indicated the existence of unpublished SRs and the potential influence of lack of funding as a reason for non-publication. Here, we investigated the publication status of registered SRs in the 1st year that PROSPERO launched and assessed the association between publication and the existence of funding or conflicts of interest (COIs). RESULTS: We identified 326 SRs registered in PROSPERO from February 2011 through February 2012. Among them, 85 SRs (26%) remained unpublished at least 65 months after registration. We found 241 published reports, including four conference abstracts and one poster presentation. Median time to publication from protocol registration was 16.3 months. Funding for SRs was associated with publication [odds ratio (OR) = 2.10; 95% confidence interval (CI) = 1.26 to 3.50]. We found no significant association of author-reported COIs with publication (OR = 2.35; 95% CI = 0.67 to 8.20). Twenty SRs were not published despite the authors reporting completion of the reviews in PROSPERO. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s13104-017-3043-5) contains supplementary material, which is available to authorized users. |
format | Online Article Text |
id | pubmed-5717810 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2017 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-57178102017-12-08 Unpublished systematic reviews and financial support: a meta-epidemiological study Tsujimoto, Hiraku Tsujimoto, Yasushi Kataoka, Yuki BMC Res Notes Research Note OBJECTIVE: PROSPERO, an international prospective register of systematic reviews, was launched in February 2011 to reduce publication bias of systematic reviews (SRs). A questionnaire survey of SR researchers conducted in 2005 indicated the existence of unpublished SRs and the potential influence of lack of funding as a reason for non-publication. Here, we investigated the publication status of registered SRs in the 1st year that PROSPERO launched and assessed the association between publication and the existence of funding or conflicts of interest (COIs). RESULTS: We identified 326 SRs registered in PROSPERO from February 2011 through February 2012. Among them, 85 SRs (26%) remained unpublished at least 65 months after registration. We found 241 published reports, including four conference abstracts and one poster presentation. Median time to publication from protocol registration was 16.3 months. Funding for SRs was associated with publication [odds ratio (OR) = 2.10; 95% confidence interval (CI) = 1.26 to 3.50]. We found no significant association of author-reported COIs with publication (OR = 2.35; 95% CI = 0.67 to 8.20). Twenty SRs were not published despite the authors reporting completion of the reviews in PROSPERO. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s13104-017-3043-5) contains supplementary material, which is available to authorized users. BioMed Central 2017-12-06 /pmc/articles/PMC5717810/ /pubmed/29208054 http://dx.doi.org/10.1186/s13104-017-3043-5 Text en © The Author(s) 2017 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Note Tsujimoto, Hiraku Tsujimoto, Yasushi Kataoka, Yuki Unpublished systematic reviews and financial support: a meta-epidemiological study |
title | Unpublished systematic reviews and financial support: a meta-epidemiological study |
title_full | Unpublished systematic reviews and financial support: a meta-epidemiological study |
title_fullStr | Unpublished systematic reviews and financial support: a meta-epidemiological study |
title_full_unstemmed | Unpublished systematic reviews and financial support: a meta-epidemiological study |
title_short | Unpublished systematic reviews and financial support: a meta-epidemiological study |
title_sort | unpublished systematic reviews and financial support: a meta-epidemiological study |
topic | Research Note |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5717810/ https://www.ncbi.nlm.nih.gov/pubmed/29208054 http://dx.doi.org/10.1186/s13104-017-3043-5 |
work_keys_str_mv | AT tsujimotohiraku unpublishedsystematicreviewsandfinancialsupportametaepidemiologicalstudy AT tsujimotoyasushi unpublishedsystematicreviewsandfinancialsupportametaepidemiologicalstudy AT kataokayuki unpublishedsystematicreviewsandfinancialsupportametaepidemiologicalstudy |