Cargando…
Quaking Deficiency Amplifies Inflammation in Experimental Endotoxemia via the Aryl Hydrocarbon Receptor/Signal Transducer and Activator of Transcription 1–NF-κB Pathway
Macrophages, characterized by considerable diversity and plasticity, play a crucial role in a broad spectrum of biological processes, including inflammation. However, the molecular mechanisms underlying the diverse phenotypes of macrophages are not well defined. Here, we show that the RNA-binding pr...
Autores principales: | , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Frontiers Media S.A.
2017
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5727050/ https://www.ncbi.nlm.nih.gov/pubmed/29276519 http://dx.doi.org/10.3389/fimmu.2017.01754 |
_version_ | 1783285792514244608 |
---|---|
author | Wang, Li Zhai, Dong-Sheng Ruan, Ban-Jun Xu, Cheng-Ming Ye, Zi-Chen Lu, Huan-Yu Jiang, Ying-Hao Wang, Zhen-Yu Xiang, An Yang, Yuan Yuan, Jian-Lin Lu, Zi-Fan |
author_facet | Wang, Li Zhai, Dong-Sheng Ruan, Ban-Jun Xu, Cheng-Ming Ye, Zi-Chen Lu, Huan-Yu Jiang, Ying-Hao Wang, Zhen-Yu Xiang, An Yang, Yuan Yuan, Jian-Lin Lu, Zi-Fan |
author_sort | Wang, Li |
collection | PubMed |
description | Macrophages, characterized by considerable diversity and plasticity, play a crucial role in a broad spectrum of biological processes, including inflammation. However, the molecular mechanisms underlying the diverse phenotypes of macrophages are not well defined. Here, we show that the RNA-binding protein, quaking (QKI), dynamically modulates macrophage polarization states. After lipopolysaccharide (LPS) stimulation, QKI-silenced RAW 264.7 cells displayed a pro-inflammatory M1 phenotype characterized by increased expression of iNOS, TNF-α, and IL-6 and decreased expression of anti-inflammatory factors, such as IL-10, found in inflammatory zone (Fizz1), and chitinase-like 3 (Chil3 or Ym1). By contrast, QKI5 overexpression led to a suppressive phenotype resembling M2 macrophages, even under M1 differentiation conditions. Moreover, myeloid-specific QKI-deficient mice tended to be more susceptible to LPS-induced endotoxic shock, while the exogenous transfer of macrophages overexpressing QKI5 exerted a significant improving effect. This improvement corresponded to a higher proportion of M2 macrophages, in line with elevated levels of IL-10, and a decrease in levels of pro-inflammatory mediators, such as IL-6, TNF-α, and IL-1β. Further mechanistic studies disclosed that QKI was a potent inhibitor of the nuclear factor-kappa B (NF-κB) pathway, suppressing p65 expression and phosphorylation. Strikingly, reduced expression of the aryl hydrocarbon receptor (Ahr) and reduced phosphorylation of signal transducer and activator of transcription 1 in QKI-deficient cells failed to restrain the transcriptional activity of NF-κB and NRL pyrin domain containing 3 (NLRP3) activation, while restoring QKI expression skewed the above M1-like response toward an anti-inflammatory M2 state. Taken together, these findings suggest a role for QKI in restraining overt innate immune responses by regulating the Ahr/STAT1–NF-κB pathway. |
format | Online Article Text |
id | pubmed-5727050 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2017 |
publisher | Frontiers Media S.A. |
record_format | MEDLINE/PubMed |
spelling | pubmed-57270502017-12-22 Quaking Deficiency Amplifies Inflammation in Experimental Endotoxemia via the Aryl Hydrocarbon Receptor/Signal Transducer and Activator of Transcription 1–NF-κB Pathway Wang, Li Zhai, Dong-Sheng Ruan, Ban-Jun Xu, Cheng-Ming Ye, Zi-Chen Lu, Huan-Yu Jiang, Ying-Hao Wang, Zhen-Yu Xiang, An Yang, Yuan Yuan, Jian-Lin Lu, Zi-Fan Front Immunol Immunology Macrophages, characterized by considerable diversity and plasticity, play a crucial role in a broad spectrum of biological processes, including inflammation. However, the molecular mechanisms underlying the diverse phenotypes of macrophages are not well defined. Here, we show that the RNA-binding protein, quaking (QKI), dynamically modulates macrophage polarization states. After lipopolysaccharide (LPS) stimulation, QKI-silenced RAW 264.7 cells displayed a pro-inflammatory M1 phenotype characterized by increased expression of iNOS, TNF-α, and IL-6 and decreased expression of anti-inflammatory factors, such as IL-10, found in inflammatory zone (Fizz1), and chitinase-like 3 (Chil3 or Ym1). By contrast, QKI5 overexpression led to a suppressive phenotype resembling M2 macrophages, even under M1 differentiation conditions. Moreover, myeloid-specific QKI-deficient mice tended to be more susceptible to LPS-induced endotoxic shock, while the exogenous transfer of macrophages overexpressing QKI5 exerted a significant improving effect. This improvement corresponded to a higher proportion of M2 macrophages, in line with elevated levels of IL-10, and a decrease in levels of pro-inflammatory mediators, such as IL-6, TNF-α, and IL-1β. Further mechanistic studies disclosed that QKI was a potent inhibitor of the nuclear factor-kappa B (NF-κB) pathway, suppressing p65 expression and phosphorylation. Strikingly, reduced expression of the aryl hydrocarbon receptor (Ahr) and reduced phosphorylation of signal transducer and activator of transcription 1 in QKI-deficient cells failed to restrain the transcriptional activity of NF-κB and NRL pyrin domain containing 3 (NLRP3) activation, while restoring QKI expression skewed the above M1-like response toward an anti-inflammatory M2 state. Taken together, these findings suggest a role for QKI in restraining overt innate immune responses by regulating the Ahr/STAT1–NF-κB pathway. Frontiers Media S.A. 2017-12-08 /pmc/articles/PMC5727050/ /pubmed/29276519 http://dx.doi.org/10.3389/fimmu.2017.01754 Text en Copyright © 2017 Wang, Zhai, Ruan, Xu, Ye, Lu, Jiang, Wang, Xiang, Yang, Yuan and Lu. http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) or licensor are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms. |
spellingShingle | Immunology Wang, Li Zhai, Dong-Sheng Ruan, Ban-Jun Xu, Cheng-Ming Ye, Zi-Chen Lu, Huan-Yu Jiang, Ying-Hao Wang, Zhen-Yu Xiang, An Yang, Yuan Yuan, Jian-Lin Lu, Zi-Fan Quaking Deficiency Amplifies Inflammation in Experimental Endotoxemia via the Aryl Hydrocarbon Receptor/Signal Transducer and Activator of Transcription 1–NF-κB Pathway |
title | Quaking Deficiency Amplifies Inflammation in Experimental Endotoxemia via the Aryl Hydrocarbon Receptor/Signal Transducer and Activator of Transcription 1–NF-κB Pathway |
title_full | Quaking Deficiency Amplifies Inflammation in Experimental Endotoxemia via the Aryl Hydrocarbon Receptor/Signal Transducer and Activator of Transcription 1–NF-κB Pathway |
title_fullStr | Quaking Deficiency Amplifies Inflammation in Experimental Endotoxemia via the Aryl Hydrocarbon Receptor/Signal Transducer and Activator of Transcription 1–NF-κB Pathway |
title_full_unstemmed | Quaking Deficiency Amplifies Inflammation in Experimental Endotoxemia via the Aryl Hydrocarbon Receptor/Signal Transducer and Activator of Transcription 1–NF-κB Pathway |
title_short | Quaking Deficiency Amplifies Inflammation in Experimental Endotoxemia via the Aryl Hydrocarbon Receptor/Signal Transducer and Activator of Transcription 1–NF-κB Pathway |
title_sort | quaking deficiency amplifies inflammation in experimental endotoxemia via the aryl hydrocarbon receptor/signal transducer and activator of transcription 1–nf-κb pathway |
topic | Immunology |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5727050/ https://www.ncbi.nlm.nih.gov/pubmed/29276519 http://dx.doi.org/10.3389/fimmu.2017.01754 |
work_keys_str_mv | AT wangli quakingdeficiencyamplifiesinflammationinexperimentalendotoxemiaviathearylhydrocarbonreceptorsignaltransducerandactivatoroftranscription1nfkbpathway AT zhaidongsheng quakingdeficiencyamplifiesinflammationinexperimentalendotoxemiaviathearylhydrocarbonreceptorsignaltransducerandactivatoroftranscription1nfkbpathway AT ruanbanjun quakingdeficiencyamplifiesinflammationinexperimentalendotoxemiaviathearylhydrocarbonreceptorsignaltransducerandactivatoroftranscription1nfkbpathway AT xuchengming quakingdeficiencyamplifiesinflammationinexperimentalendotoxemiaviathearylhydrocarbonreceptorsignaltransducerandactivatoroftranscription1nfkbpathway AT yezichen quakingdeficiencyamplifiesinflammationinexperimentalendotoxemiaviathearylhydrocarbonreceptorsignaltransducerandactivatoroftranscription1nfkbpathway AT luhuanyu quakingdeficiencyamplifiesinflammationinexperimentalendotoxemiaviathearylhydrocarbonreceptorsignaltransducerandactivatoroftranscription1nfkbpathway AT jiangyinghao quakingdeficiencyamplifiesinflammationinexperimentalendotoxemiaviathearylhydrocarbonreceptorsignaltransducerandactivatoroftranscription1nfkbpathway AT wangzhenyu quakingdeficiencyamplifiesinflammationinexperimentalendotoxemiaviathearylhydrocarbonreceptorsignaltransducerandactivatoroftranscription1nfkbpathway AT xiangan quakingdeficiencyamplifiesinflammationinexperimentalendotoxemiaviathearylhydrocarbonreceptorsignaltransducerandactivatoroftranscription1nfkbpathway AT yangyuan quakingdeficiencyamplifiesinflammationinexperimentalendotoxemiaviathearylhydrocarbonreceptorsignaltransducerandactivatoroftranscription1nfkbpathway AT yuanjianlin quakingdeficiencyamplifiesinflammationinexperimentalendotoxemiaviathearylhydrocarbonreceptorsignaltransducerandactivatoroftranscription1nfkbpathway AT luzifan quakingdeficiencyamplifiesinflammationinexperimentalendotoxemiaviathearylhydrocarbonreceptorsignaltransducerandactivatoroftranscription1nfkbpathway |