Cargando…

The Arabidopsis thaliana F-box gene HAWAIIAN SKIRT is a new player in the microRNA pathway

In Arabidopsis, the F-box HAWAIIAN SKIRT (HWS) protein is important for organ growth. Loss of function of HWS exhibits pleiotropic phenotypes including sepal fusion. To dissect the HWS role, we EMS-mutagenized hws-1 seeds and screened for mutations that suppress hws-1 associated phenotypes. We ident...

Descripción completa

Detalles Bibliográficos
Autores principales: Zhang, Xuebin, Jayaweera, Dasuni, Peters, Janny L., Szecsi, Judit, Bendahmane, Mohammed, Roberts, Jeremy A., González-Carranza, Zinnia H.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Public Library of Science 2017
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5731758/
https://www.ncbi.nlm.nih.gov/pubmed/29244865
http://dx.doi.org/10.1371/journal.pone.0189788
_version_ 1783286563953704960
author Zhang, Xuebin
Jayaweera, Dasuni
Peters, Janny L.
Szecsi, Judit
Bendahmane, Mohammed
Roberts, Jeremy A.
González-Carranza, Zinnia H.
author_facet Zhang, Xuebin
Jayaweera, Dasuni
Peters, Janny L.
Szecsi, Judit
Bendahmane, Mohammed
Roberts, Jeremy A.
González-Carranza, Zinnia H.
author_sort Zhang, Xuebin
collection PubMed
description In Arabidopsis, the F-box HAWAIIAN SKIRT (HWS) protein is important for organ growth. Loss of function of HWS exhibits pleiotropic phenotypes including sepal fusion. To dissect the HWS role, we EMS-mutagenized hws-1 seeds and screened for mutations that suppress hws-1 associated phenotypes. We identified shs-2 and shs-3 (suppressor of hws-2 and 3) mutants in which the sepal fusion phenotype of hws-1 was suppressed. shs-2 and shs-3 (renamed hst-23/hws-1 and hst-24/hws-1) carry transition mutations that result in premature terminations in the plant homolog of Exportin-5 HASTY (HST), known to be important in miRNA biogenesis, function and transport. Genetic crosses between hws-1 and mutant lines for genes in the miRNA pathway also suppress the phenotypes associated with HWS loss of function, corroborating epistatic relations between the miRNA pathway genes and HWS. In agreement with these data, accumulation of miRNA is modified in HWS loss or gain of function mutants. Our data propose HWS as a new player in the miRNA pathway, important for plant growth.
format Online
Article
Text
id pubmed-5731758
institution National Center for Biotechnology Information
language English
publishDate 2017
publisher Public Library of Science
record_format MEDLINE/PubMed
spelling pubmed-57317582017-12-22 The Arabidopsis thaliana F-box gene HAWAIIAN SKIRT is a new player in the microRNA pathway Zhang, Xuebin Jayaweera, Dasuni Peters, Janny L. Szecsi, Judit Bendahmane, Mohammed Roberts, Jeremy A. González-Carranza, Zinnia H. PLoS One Research Article In Arabidopsis, the F-box HAWAIIAN SKIRT (HWS) protein is important for organ growth. Loss of function of HWS exhibits pleiotropic phenotypes including sepal fusion. To dissect the HWS role, we EMS-mutagenized hws-1 seeds and screened for mutations that suppress hws-1 associated phenotypes. We identified shs-2 and shs-3 (suppressor of hws-2 and 3) mutants in which the sepal fusion phenotype of hws-1 was suppressed. shs-2 and shs-3 (renamed hst-23/hws-1 and hst-24/hws-1) carry transition mutations that result in premature terminations in the plant homolog of Exportin-5 HASTY (HST), known to be important in miRNA biogenesis, function and transport. Genetic crosses between hws-1 and mutant lines for genes in the miRNA pathway also suppress the phenotypes associated with HWS loss of function, corroborating epistatic relations between the miRNA pathway genes and HWS. In agreement with these data, accumulation of miRNA is modified in HWS loss or gain of function mutants. Our data propose HWS as a new player in the miRNA pathway, important for plant growth. Public Library of Science 2017-12-15 /pmc/articles/PMC5731758/ /pubmed/29244865 http://dx.doi.org/10.1371/journal.pone.0189788 Text en © 2017 Zhang et al http://creativecommons.org/licenses/by/4.0/ This is an open access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/) , which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited.
spellingShingle Research Article
Zhang, Xuebin
Jayaweera, Dasuni
Peters, Janny L.
Szecsi, Judit
Bendahmane, Mohammed
Roberts, Jeremy A.
González-Carranza, Zinnia H.
The Arabidopsis thaliana F-box gene HAWAIIAN SKIRT is a new player in the microRNA pathway
title The Arabidopsis thaliana F-box gene HAWAIIAN SKIRT is a new player in the microRNA pathway
title_full The Arabidopsis thaliana F-box gene HAWAIIAN SKIRT is a new player in the microRNA pathway
title_fullStr The Arabidopsis thaliana F-box gene HAWAIIAN SKIRT is a new player in the microRNA pathway
title_full_unstemmed The Arabidopsis thaliana F-box gene HAWAIIAN SKIRT is a new player in the microRNA pathway
title_short The Arabidopsis thaliana F-box gene HAWAIIAN SKIRT is a new player in the microRNA pathway
title_sort arabidopsis thaliana f-box gene hawaiian skirt is a new player in the microrna pathway
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5731758/
https://www.ncbi.nlm.nih.gov/pubmed/29244865
http://dx.doi.org/10.1371/journal.pone.0189788
work_keys_str_mv AT zhangxuebin thearabidopsisthalianafboxgenehawaiianskirtisanewplayerinthemicrornapathway
AT jayaweeradasuni thearabidopsisthalianafboxgenehawaiianskirtisanewplayerinthemicrornapathway
AT petersjannyl thearabidopsisthalianafboxgenehawaiianskirtisanewplayerinthemicrornapathway
AT szecsijudit thearabidopsisthalianafboxgenehawaiianskirtisanewplayerinthemicrornapathway
AT bendahmanemohammed thearabidopsisthalianafboxgenehawaiianskirtisanewplayerinthemicrornapathway
AT robertsjeremya thearabidopsisthalianafboxgenehawaiianskirtisanewplayerinthemicrornapathway
AT gonzalezcarranzazinniah thearabidopsisthalianafboxgenehawaiianskirtisanewplayerinthemicrornapathway
AT zhangxuebin arabidopsisthalianafboxgenehawaiianskirtisanewplayerinthemicrornapathway
AT jayaweeradasuni arabidopsisthalianafboxgenehawaiianskirtisanewplayerinthemicrornapathway
AT petersjannyl arabidopsisthalianafboxgenehawaiianskirtisanewplayerinthemicrornapathway
AT szecsijudit arabidopsisthalianafboxgenehawaiianskirtisanewplayerinthemicrornapathway
AT bendahmanemohammed arabidopsisthalianafboxgenehawaiianskirtisanewplayerinthemicrornapathway
AT robertsjeremya arabidopsisthalianafboxgenehawaiianskirtisanewplayerinthemicrornapathway
AT gonzalezcarranzazinniah arabidopsisthalianafboxgenehawaiianskirtisanewplayerinthemicrornapathway