Cargando…
The Arabidopsis thaliana F-box gene HAWAIIAN SKIRT is a new player in the microRNA pathway
In Arabidopsis, the F-box HAWAIIAN SKIRT (HWS) protein is important for organ growth. Loss of function of HWS exhibits pleiotropic phenotypes including sepal fusion. To dissect the HWS role, we EMS-mutagenized hws-1 seeds and screened for mutations that suppress hws-1 associated phenotypes. We ident...
Autores principales: | , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Public Library of Science
2017
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5731758/ https://www.ncbi.nlm.nih.gov/pubmed/29244865 http://dx.doi.org/10.1371/journal.pone.0189788 |
_version_ | 1783286563953704960 |
---|---|
author | Zhang, Xuebin Jayaweera, Dasuni Peters, Janny L. Szecsi, Judit Bendahmane, Mohammed Roberts, Jeremy A. González-Carranza, Zinnia H. |
author_facet | Zhang, Xuebin Jayaweera, Dasuni Peters, Janny L. Szecsi, Judit Bendahmane, Mohammed Roberts, Jeremy A. González-Carranza, Zinnia H. |
author_sort | Zhang, Xuebin |
collection | PubMed |
description | In Arabidopsis, the F-box HAWAIIAN SKIRT (HWS) protein is important for organ growth. Loss of function of HWS exhibits pleiotropic phenotypes including sepal fusion. To dissect the HWS role, we EMS-mutagenized hws-1 seeds and screened for mutations that suppress hws-1 associated phenotypes. We identified shs-2 and shs-3 (suppressor of hws-2 and 3) mutants in which the sepal fusion phenotype of hws-1 was suppressed. shs-2 and shs-3 (renamed hst-23/hws-1 and hst-24/hws-1) carry transition mutations that result in premature terminations in the plant homolog of Exportin-5 HASTY (HST), known to be important in miRNA biogenesis, function and transport. Genetic crosses between hws-1 and mutant lines for genes in the miRNA pathway also suppress the phenotypes associated with HWS loss of function, corroborating epistatic relations between the miRNA pathway genes and HWS. In agreement with these data, accumulation of miRNA is modified in HWS loss or gain of function mutants. Our data propose HWS as a new player in the miRNA pathway, important for plant growth. |
format | Online Article Text |
id | pubmed-5731758 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2017 |
publisher | Public Library of Science |
record_format | MEDLINE/PubMed |
spelling | pubmed-57317582017-12-22 The Arabidopsis thaliana F-box gene HAWAIIAN SKIRT is a new player in the microRNA pathway Zhang, Xuebin Jayaweera, Dasuni Peters, Janny L. Szecsi, Judit Bendahmane, Mohammed Roberts, Jeremy A. González-Carranza, Zinnia H. PLoS One Research Article In Arabidopsis, the F-box HAWAIIAN SKIRT (HWS) protein is important for organ growth. Loss of function of HWS exhibits pleiotropic phenotypes including sepal fusion. To dissect the HWS role, we EMS-mutagenized hws-1 seeds and screened for mutations that suppress hws-1 associated phenotypes. We identified shs-2 and shs-3 (suppressor of hws-2 and 3) mutants in which the sepal fusion phenotype of hws-1 was suppressed. shs-2 and shs-3 (renamed hst-23/hws-1 and hst-24/hws-1) carry transition mutations that result in premature terminations in the plant homolog of Exportin-5 HASTY (HST), known to be important in miRNA biogenesis, function and transport. Genetic crosses between hws-1 and mutant lines for genes in the miRNA pathway also suppress the phenotypes associated with HWS loss of function, corroborating epistatic relations between the miRNA pathway genes and HWS. In agreement with these data, accumulation of miRNA is modified in HWS loss or gain of function mutants. Our data propose HWS as a new player in the miRNA pathway, important for plant growth. Public Library of Science 2017-12-15 /pmc/articles/PMC5731758/ /pubmed/29244865 http://dx.doi.org/10.1371/journal.pone.0189788 Text en © 2017 Zhang et al http://creativecommons.org/licenses/by/4.0/ This is an open access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/) , which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited. |
spellingShingle | Research Article Zhang, Xuebin Jayaweera, Dasuni Peters, Janny L. Szecsi, Judit Bendahmane, Mohammed Roberts, Jeremy A. González-Carranza, Zinnia H. The Arabidopsis thaliana F-box gene HAWAIIAN SKIRT is a new player in the microRNA pathway |
title | The Arabidopsis thaliana F-box gene HAWAIIAN SKIRT is a new player in the microRNA pathway |
title_full | The Arabidopsis thaliana F-box gene HAWAIIAN SKIRT is a new player in the microRNA pathway |
title_fullStr | The Arabidopsis thaliana F-box gene HAWAIIAN SKIRT is a new player in the microRNA pathway |
title_full_unstemmed | The Arabidopsis thaliana F-box gene HAWAIIAN SKIRT is a new player in the microRNA pathway |
title_short | The Arabidopsis thaliana F-box gene HAWAIIAN SKIRT is a new player in the microRNA pathway |
title_sort | arabidopsis thaliana f-box gene hawaiian skirt is a new player in the microrna pathway |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5731758/ https://www.ncbi.nlm.nih.gov/pubmed/29244865 http://dx.doi.org/10.1371/journal.pone.0189788 |
work_keys_str_mv | AT zhangxuebin thearabidopsisthalianafboxgenehawaiianskirtisanewplayerinthemicrornapathway AT jayaweeradasuni thearabidopsisthalianafboxgenehawaiianskirtisanewplayerinthemicrornapathway AT petersjannyl thearabidopsisthalianafboxgenehawaiianskirtisanewplayerinthemicrornapathway AT szecsijudit thearabidopsisthalianafboxgenehawaiianskirtisanewplayerinthemicrornapathway AT bendahmanemohammed thearabidopsisthalianafboxgenehawaiianskirtisanewplayerinthemicrornapathway AT robertsjeremya thearabidopsisthalianafboxgenehawaiianskirtisanewplayerinthemicrornapathway AT gonzalezcarranzazinniah thearabidopsisthalianafboxgenehawaiianskirtisanewplayerinthemicrornapathway AT zhangxuebin arabidopsisthalianafboxgenehawaiianskirtisanewplayerinthemicrornapathway AT jayaweeradasuni arabidopsisthalianafboxgenehawaiianskirtisanewplayerinthemicrornapathway AT petersjannyl arabidopsisthalianafboxgenehawaiianskirtisanewplayerinthemicrornapathway AT szecsijudit arabidopsisthalianafboxgenehawaiianskirtisanewplayerinthemicrornapathway AT bendahmanemohammed arabidopsisthalianafboxgenehawaiianskirtisanewplayerinthemicrornapathway AT robertsjeremya arabidopsisthalianafboxgenehawaiianskirtisanewplayerinthemicrornapathway AT gonzalezcarranzazinniah arabidopsisthalianafboxgenehawaiianskirtisanewplayerinthemicrornapathway |