Cargando…

The association between HIV and atherosclerotic cardiovascular disease in sub-Saharan Africa: a systematic review

BACKGROUND: Sub-Saharan Africa (SSA) has confronted decades of the HIV epidemic with substantial improvements in access to life-saving antiretroviral therapy (ART). Now, with improved survival, people living with HIV (PLWH) are at increased risk for non-communicable diseases (NCDs), including athero...

Descripción completa

Detalles Bibliográficos
Autores principales: Hyle, Emily P., Mayosi, Bongani M., Middelkoop, Keren, Mosepele, Mosepele, Martey, Emily B., Walensky, Rochelle P., Bekker, Linda-Gail, Triant, Virginia A.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2017
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5732372/
https://www.ncbi.nlm.nih.gov/pubmed/29246206
http://dx.doi.org/10.1186/s12889-017-4940-1
_version_ 1783286681456082944
author Hyle, Emily P.
Mayosi, Bongani M.
Middelkoop, Keren
Mosepele, Mosepele
Martey, Emily B.
Walensky, Rochelle P.
Bekker, Linda-Gail
Triant, Virginia A.
author_facet Hyle, Emily P.
Mayosi, Bongani M.
Middelkoop, Keren
Mosepele, Mosepele
Martey, Emily B.
Walensky, Rochelle P.
Bekker, Linda-Gail
Triant, Virginia A.
author_sort Hyle, Emily P.
collection PubMed
description BACKGROUND: Sub-Saharan Africa (SSA) has confronted decades of the HIV epidemic with substantial improvements in access to life-saving antiretroviral therapy (ART). Now, with improved survival, people living with HIV (PLWH) are at increased risk for non-communicable diseases (NCDs), including atherosclerotic cardiovascular disease (CVD). We assessed the existing literature regarding the association of CVD outcomes and HIV in SSA. METHODS: We used the PRISMA guidelines to perform a systematic review of the published literature regarding the association of CVD and HIV in SSA with a focus on CVD surrogate and clinical outcomes in PLWH. RESULTS: From January 2000 until March 2017, 31 articles were published regarding CVD outcomes among PLWH in SSA. Data from surrogate CVD outcomes (n = 13) suggest an increased risk of CVD events among PLWH in SSA. Although acute coronary syndrome is reported infrequently in SSA among PLWH, limited data from five studies suggest extensive thrombus and hypercoagulability as contributing factors. Additional studies suggest an increased risk of stroke among PLWH (n = 13); however, most data are from immunosuppressed ART-naïve PLWH and thus are potentially confounded by the possibility of central nervous system infections. CONCLUSIONS: Given ongoing gaps in our current understanding of CVD and other NCDs in PLWH in SSA, it is imperative to ascertain the burden of CVD outcomes, and to examine strategies for intervention and best practices to enhance the health of this vulnerable population. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s12889-017-4940-1) contains supplementary material, which is available to authorized users.
format Online
Article
Text
id pubmed-5732372
institution National Center for Biotechnology Information
language English
publishDate 2017
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-57323722017-12-21 The association between HIV and atherosclerotic cardiovascular disease in sub-Saharan Africa: a systematic review Hyle, Emily P. Mayosi, Bongani M. Middelkoop, Keren Mosepele, Mosepele Martey, Emily B. Walensky, Rochelle P. Bekker, Linda-Gail Triant, Virginia A. BMC Public Health Research Article BACKGROUND: Sub-Saharan Africa (SSA) has confronted decades of the HIV epidemic with substantial improvements in access to life-saving antiretroviral therapy (ART). Now, with improved survival, people living with HIV (PLWH) are at increased risk for non-communicable diseases (NCDs), including atherosclerotic cardiovascular disease (CVD). We assessed the existing literature regarding the association of CVD outcomes and HIV in SSA. METHODS: We used the PRISMA guidelines to perform a systematic review of the published literature regarding the association of CVD and HIV in SSA with a focus on CVD surrogate and clinical outcomes in PLWH. RESULTS: From January 2000 until March 2017, 31 articles were published regarding CVD outcomes among PLWH in SSA. Data from surrogate CVD outcomes (n = 13) suggest an increased risk of CVD events among PLWH in SSA. Although acute coronary syndrome is reported infrequently in SSA among PLWH, limited data from five studies suggest extensive thrombus and hypercoagulability as contributing factors. Additional studies suggest an increased risk of stroke among PLWH (n = 13); however, most data are from immunosuppressed ART-naïve PLWH and thus are potentially confounded by the possibility of central nervous system infections. CONCLUSIONS: Given ongoing gaps in our current understanding of CVD and other NCDs in PLWH in SSA, it is imperative to ascertain the burden of CVD outcomes, and to examine strategies for intervention and best practices to enhance the health of this vulnerable population. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s12889-017-4940-1) contains supplementary material, which is available to authorized users. BioMed Central 2017-12-15 /pmc/articles/PMC5732372/ /pubmed/29246206 http://dx.doi.org/10.1186/s12889-017-4940-1 Text en © The Author(s). 2017 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research Article
Hyle, Emily P.
Mayosi, Bongani M.
Middelkoop, Keren
Mosepele, Mosepele
Martey, Emily B.
Walensky, Rochelle P.
Bekker, Linda-Gail
Triant, Virginia A.
The association between HIV and atherosclerotic cardiovascular disease in sub-Saharan Africa: a systematic review
title The association between HIV and atherosclerotic cardiovascular disease in sub-Saharan Africa: a systematic review
title_full The association between HIV and atherosclerotic cardiovascular disease in sub-Saharan Africa: a systematic review
title_fullStr The association between HIV and atherosclerotic cardiovascular disease in sub-Saharan Africa: a systematic review
title_full_unstemmed The association between HIV and atherosclerotic cardiovascular disease in sub-Saharan Africa: a systematic review
title_short The association between HIV and atherosclerotic cardiovascular disease in sub-Saharan Africa: a systematic review
title_sort association between hiv and atherosclerotic cardiovascular disease in sub-saharan africa: a systematic review
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5732372/
https://www.ncbi.nlm.nih.gov/pubmed/29246206
http://dx.doi.org/10.1186/s12889-017-4940-1
work_keys_str_mv AT hyleemilyp theassociationbetweenhivandatheroscleroticcardiovasculardiseaseinsubsaharanafricaasystematicreview
AT mayosibonganim theassociationbetweenhivandatheroscleroticcardiovasculardiseaseinsubsaharanafricaasystematicreview
AT middelkoopkeren theassociationbetweenhivandatheroscleroticcardiovasculardiseaseinsubsaharanafricaasystematicreview
AT mosepelemosepele theassociationbetweenhivandatheroscleroticcardiovasculardiseaseinsubsaharanafricaasystematicreview
AT marteyemilyb theassociationbetweenhivandatheroscleroticcardiovasculardiseaseinsubsaharanafricaasystematicreview
AT walenskyrochellep theassociationbetweenhivandatheroscleroticcardiovasculardiseaseinsubsaharanafricaasystematicreview
AT bekkerlindagail theassociationbetweenhivandatheroscleroticcardiovasculardiseaseinsubsaharanafricaasystematicreview
AT triantvirginiaa theassociationbetweenhivandatheroscleroticcardiovasculardiseaseinsubsaharanafricaasystematicreview
AT hyleemilyp associationbetweenhivandatheroscleroticcardiovasculardiseaseinsubsaharanafricaasystematicreview
AT mayosibonganim associationbetweenhivandatheroscleroticcardiovasculardiseaseinsubsaharanafricaasystematicreview
AT middelkoopkeren associationbetweenhivandatheroscleroticcardiovasculardiseaseinsubsaharanafricaasystematicreview
AT mosepelemosepele associationbetweenhivandatheroscleroticcardiovasculardiseaseinsubsaharanafricaasystematicreview
AT marteyemilyb associationbetweenhivandatheroscleroticcardiovasculardiseaseinsubsaharanafricaasystematicreview
AT walenskyrochellep associationbetweenhivandatheroscleroticcardiovasculardiseaseinsubsaharanafricaasystematicreview
AT bekkerlindagail associationbetweenhivandatheroscleroticcardiovasculardiseaseinsubsaharanafricaasystematicreview
AT triantvirginiaa associationbetweenhivandatheroscleroticcardiovasculardiseaseinsubsaharanafricaasystematicreview