Cargando…

Predictor of the Simplified Disease Activity Index 50 (SDAI 50) at Month 3 of bDMARD Treatment in Patients with Long-Established Rheumatoid Arthritis

OBJECTIVES: The Simplified Disease Activity Index (SDAI) 50 has good agreement with European League Against Rheumatism (EULAR) response measures for early Rheumatoid Arthritis (RA). There have been reports on early RA, but not on long-established RA. In this study, we analysed the relationships betw...

Descripción completa

Detalles Bibliográficos
Autores principales: Miwa, Yusuke, Saito, Mayu, Furuya, Hidekazu, Yanai, Ryo, Kasama, Tsuyoshi
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Bentham Open 2017
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5737026/
https://www.ncbi.nlm.nih.gov/pubmed/29290847
http://dx.doi.org/10.2174/1874312901711010106
_version_ 1783287463473577984
author Miwa, Yusuke
Saito, Mayu
Furuya, Hidekazu
Yanai, Ryo
Kasama, Tsuyoshi
author_facet Miwa, Yusuke
Saito, Mayu
Furuya, Hidekazu
Yanai, Ryo
Kasama, Tsuyoshi
author_sort Miwa, Yusuke
collection PubMed
description OBJECTIVES: The Simplified Disease Activity Index (SDAI) 50 has good agreement with European League Against Rheumatism (EULAR) response measures for early Rheumatoid Arthritis (RA). There have been reports on early RA, but not on long-established RA. In this study, we analysed the relationships between various baseline factors and SDAI 50 after three months of treatment with biological disease-modifying antirheumatic drugs (bDMARDs) to determine the prognostic factors for long-established RA. METHODS: Subjects were 260 RA patients who had been treated with bDMARDs for 3 months. The following characteristics were investigated: Patient backgrounds, the erythrocyte sedimentation rate (ESR), C-reactive protein and serum matrix metalloproteinase-3 levels, SDAI scores, and health assessment questionnaire disability index and short form-36 scores. As a primary outcome index, the SDAI response was defined as a 50% reduction in the SDAI score between baseline and 3 months (SDAI 50). RESULTS: Baseline values of disease duration (odds ratio: 0.942, 95% CI: 0.902-0.984), smoking history (odds ratio: 2.272, 1.064-4.850), 28-tender joint count (odds ratio: 0.899, 0.827-0.977), evaluator's global assessment (odds ratio: 1.029, 1.012-1.047) and ESR (odds ratio: 1.015, 1.001-1.030) were determined to be significant factors based on logistic regression analysis. CONCLUSION: Our study demonstrated that RA patients with shorter disease duration, no smoking, and higher RA disease activity are more likely to achieve SDAI 50 through bDMARD treatment.
format Online
Article
Text
id pubmed-5737026
institution National Center for Biotechnology Information
language English
publishDate 2017
publisher Bentham Open
record_format MEDLINE/PubMed
spelling pubmed-57370262017-12-29 Predictor of the Simplified Disease Activity Index 50 (SDAI 50) at Month 3 of bDMARD Treatment in Patients with Long-Established Rheumatoid Arthritis Miwa, Yusuke Saito, Mayu Furuya, Hidekazu Yanai, Ryo Kasama, Tsuyoshi Open Rheumatol J Article OBJECTIVES: The Simplified Disease Activity Index (SDAI) 50 has good agreement with European League Against Rheumatism (EULAR) response measures for early Rheumatoid Arthritis (RA). There have been reports on early RA, but not on long-established RA. In this study, we analysed the relationships between various baseline factors and SDAI 50 after three months of treatment with biological disease-modifying antirheumatic drugs (bDMARDs) to determine the prognostic factors for long-established RA. METHODS: Subjects were 260 RA patients who had been treated with bDMARDs for 3 months. The following characteristics were investigated: Patient backgrounds, the erythrocyte sedimentation rate (ESR), C-reactive protein and serum matrix metalloproteinase-3 levels, SDAI scores, and health assessment questionnaire disability index and short form-36 scores. As a primary outcome index, the SDAI response was defined as a 50% reduction in the SDAI score between baseline and 3 months (SDAI 50). RESULTS: Baseline values of disease duration (odds ratio: 0.942, 95% CI: 0.902-0.984), smoking history (odds ratio: 2.272, 1.064-4.850), 28-tender joint count (odds ratio: 0.899, 0.827-0.977), evaluator's global assessment (odds ratio: 1.029, 1.012-1.047) and ESR (odds ratio: 1.015, 1.001-1.030) were determined to be significant factors based on logistic regression analysis. CONCLUSION: Our study demonstrated that RA patients with shorter disease duration, no smoking, and higher RA disease activity are more likely to achieve SDAI 50 through bDMARD treatment. Bentham Open 2017-09-30 /pmc/articles/PMC5737026/ /pubmed/29290847 http://dx.doi.org/10.2174/1874312901711010106 Text en © 2017 Miwa et al. https://creativecommons.org/licenses/by/4.0/legalcode This is an open access article distributed under the terms of the Creative Commons Attribution 4.0 International Public License (CC-BY 4.0), a copy of which is available at: (https://creativecommons.org/licenses/by/4.0/legalcode). This license permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited.
spellingShingle Article
Miwa, Yusuke
Saito, Mayu
Furuya, Hidekazu
Yanai, Ryo
Kasama, Tsuyoshi
Predictor of the Simplified Disease Activity Index 50 (SDAI 50) at Month 3 of bDMARD Treatment in Patients with Long-Established Rheumatoid Arthritis
title Predictor of the Simplified Disease Activity Index 50 (SDAI 50) at Month 3 of bDMARD Treatment in Patients with Long-Established Rheumatoid Arthritis
title_full Predictor of the Simplified Disease Activity Index 50 (SDAI 50) at Month 3 of bDMARD Treatment in Patients with Long-Established Rheumatoid Arthritis
title_fullStr Predictor of the Simplified Disease Activity Index 50 (SDAI 50) at Month 3 of bDMARD Treatment in Patients with Long-Established Rheumatoid Arthritis
title_full_unstemmed Predictor of the Simplified Disease Activity Index 50 (SDAI 50) at Month 3 of bDMARD Treatment in Patients with Long-Established Rheumatoid Arthritis
title_short Predictor of the Simplified Disease Activity Index 50 (SDAI 50) at Month 3 of bDMARD Treatment in Patients with Long-Established Rheumatoid Arthritis
title_sort predictor of the simplified disease activity index 50 (sdai 50) at month 3 of bdmard treatment in patients with long-established rheumatoid arthritis
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5737026/
https://www.ncbi.nlm.nih.gov/pubmed/29290847
http://dx.doi.org/10.2174/1874312901711010106
work_keys_str_mv AT miwayusuke predictorofthesimplifieddiseaseactivityindex50sdai50atmonth3ofbdmardtreatmentinpatientswithlongestablishedrheumatoidarthritis
AT saitomayu predictorofthesimplifieddiseaseactivityindex50sdai50atmonth3ofbdmardtreatmentinpatientswithlongestablishedrheumatoidarthritis
AT furuyahidekazu predictorofthesimplifieddiseaseactivityindex50sdai50atmonth3ofbdmardtreatmentinpatientswithlongestablishedrheumatoidarthritis
AT yanairyo predictorofthesimplifieddiseaseactivityindex50sdai50atmonth3ofbdmardtreatmentinpatientswithlongestablishedrheumatoidarthritis
AT kasamatsuyoshi predictorofthesimplifieddiseaseactivityindex50sdai50atmonth3ofbdmardtreatmentinpatientswithlongestablishedrheumatoidarthritis