Cargando…
Predictor of the Simplified Disease Activity Index 50 (SDAI 50) at Month 3 of bDMARD Treatment in Patients with Long-Established Rheumatoid Arthritis
OBJECTIVES: The Simplified Disease Activity Index (SDAI) 50 has good agreement with European League Against Rheumatism (EULAR) response measures for early Rheumatoid Arthritis (RA). There have been reports on early RA, but not on long-established RA. In this study, we analysed the relationships betw...
Autores principales: | , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Bentham Open
2017
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5737026/ https://www.ncbi.nlm.nih.gov/pubmed/29290847 http://dx.doi.org/10.2174/1874312901711010106 |
_version_ | 1783287463473577984 |
---|---|
author | Miwa, Yusuke Saito, Mayu Furuya, Hidekazu Yanai, Ryo Kasama, Tsuyoshi |
author_facet | Miwa, Yusuke Saito, Mayu Furuya, Hidekazu Yanai, Ryo Kasama, Tsuyoshi |
author_sort | Miwa, Yusuke |
collection | PubMed |
description | OBJECTIVES: The Simplified Disease Activity Index (SDAI) 50 has good agreement with European League Against Rheumatism (EULAR) response measures for early Rheumatoid Arthritis (RA). There have been reports on early RA, but not on long-established RA. In this study, we analysed the relationships between various baseline factors and SDAI 50 after three months of treatment with biological disease-modifying antirheumatic drugs (bDMARDs) to determine the prognostic factors for long-established RA. METHODS: Subjects were 260 RA patients who had been treated with bDMARDs for 3 months. The following characteristics were investigated: Patient backgrounds, the erythrocyte sedimentation rate (ESR), C-reactive protein and serum matrix metalloproteinase-3 levels, SDAI scores, and health assessment questionnaire disability index and short form-36 scores. As a primary outcome index, the SDAI response was defined as a 50% reduction in the SDAI score between baseline and 3 months (SDAI 50). RESULTS: Baseline values of disease duration (odds ratio: 0.942, 95% CI: 0.902-0.984), smoking history (odds ratio: 2.272, 1.064-4.850), 28-tender joint count (odds ratio: 0.899, 0.827-0.977), evaluator's global assessment (odds ratio: 1.029, 1.012-1.047) and ESR (odds ratio: 1.015, 1.001-1.030) were determined to be significant factors based on logistic regression analysis. CONCLUSION: Our study demonstrated that RA patients with shorter disease duration, no smoking, and higher RA disease activity are more likely to achieve SDAI 50 through bDMARD treatment. |
format | Online Article Text |
id | pubmed-5737026 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2017 |
publisher | Bentham Open |
record_format | MEDLINE/PubMed |
spelling | pubmed-57370262017-12-29 Predictor of the Simplified Disease Activity Index 50 (SDAI 50) at Month 3 of bDMARD Treatment in Patients with Long-Established Rheumatoid Arthritis Miwa, Yusuke Saito, Mayu Furuya, Hidekazu Yanai, Ryo Kasama, Tsuyoshi Open Rheumatol J Article OBJECTIVES: The Simplified Disease Activity Index (SDAI) 50 has good agreement with European League Against Rheumatism (EULAR) response measures for early Rheumatoid Arthritis (RA). There have been reports on early RA, but not on long-established RA. In this study, we analysed the relationships between various baseline factors and SDAI 50 after three months of treatment with biological disease-modifying antirheumatic drugs (bDMARDs) to determine the prognostic factors for long-established RA. METHODS: Subjects were 260 RA patients who had been treated with bDMARDs for 3 months. The following characteristics were investigated: Patient backgrounds, the erythrocyte sedimentation rate (ESR), C-reactive protein and serum matrix metalloproteinase-3 levels, SDAI scores, and health assessment questionnaire disability index and short form-36 scores. As a primary outcome index, the SDAI response was defined as a 50% reduction in the SDAI score between baseline and 3 months (SDAI 50). RESULTS: Baseline values of disease duration (odds ratio: 0.942, 95% CI: 0.902-0.984), smoking history (odds ratio: 2.272, 1.064-4.850), 28-tender joint count (odds ratio: 0.899, 0.827-0.977), evaluator's global assessment (odds ratio: 1.029, 1.012-1.047) and ESR (odds ratio: 1.015, 1.001-1.030) were determined to be significant factors based on logistic regression analysis. CONCLUSION: Our study demonstrated that RA patients with shorter disease duration, no smoking, and higher RA disease activity are more likely to achieve SDAI 50 through bDMARD treatment. Bentham Open 2017-09-30 /pmc/articles/PMC5737026/ /pubmed/29290847 http://dx.doi.org/10.2174/1874312901711010106 Text en © 2017 Miwa et al. https://creativecommons.org/licenses/by/4.0/legalcode This is an open access article distributed under the terms of the Creative Commons Attribution 4.0 International Public License (CC-BY 4.0), a copy of which is available at: (https://creativecommons.org/licenses/by/4.0/legalcode). This license permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited. |
spellingShingle | Article Miwa, Yusuke Saito, Mayu Furuya, Hidekazu Yanai, Ryo Kasama, Tsuyoshi Predictor of the Simplified Disease Activity Index 50 (SDAI 50) at Month 3 of bDMARD Treatment in Patients with Long-Established Rheumatoid Arthritis |
title | Predictor of the Simplified Disease Activity Index 50 (SDAI 50) at Month 3 of bDMARD Treatment in Patients with Long-Established Rheumatoid Arthritis |
title_full | Predictor of the Simplified Disease Activity Index 50 (SDAI 50) at Month 3 of bDMARD Treatment in Patients with Long-Established Rheumatoid Arthritis |
title_fullStr | Predictor of the Simplified Disease Activity Index 50 (SDAI 50) at Month 3 of bDMARD Treatment in Patients with Long-Established Rheumatoid Arthritis |
title_full_unstemmed | Predictor of the Simplified Disease Activity Index 50 (SDAI 50) at Month 3 of bDMARD Treatment in Patients with Long-Established Rheumatoid Arthritis |
title_short | Predictor of the Simplified Disease Activity Index 50 (SDAI 50) at Month 3 of bDMARD Treatment in Patients with Long-Established Rheumatoid Arthritis |
title_sort | predictor of the simplified disease activity index 50 (sdai 50) at month 3 of bdmard treatment in patients with long-established rheumatoid arthritis |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5737026/ https://www.ncbi.nlm.nih.gov/pubmed/29290847 http://dx.doi.org/10.2174/1874312901711010106 |
work_keys_str_mv | AT miwayusuke predictorofthesimplifieddiseaseactivityindex50sdai50atmonth3ofbdmardtreatmentinpatientswithlongestablishedrheumatoidarthritis AT saitomayu predictorofthesimplifieddiseaseactivityindex50sdai50atmonth3ofbdmardtreatmentinpatientswithlongestablishedrheumatoidarthritis AT furuyahidekazu predictorofthesimplifieddiseaseactivityindex50sdai50atmonth3ofbdmardtreatmentinpatientswithlongestablishedrheumatoidarthritis AT yanairyo predictorofthesimplifieddiseaseactivityindex50sdai50atmonth3ofbdmardtreatmentinpatientswithlongestablishedrheumatoidarthritis AT kasamatsuyoshi predictorofthesimplifieddiseaseactivityindex50sdai50atmonth3ofbdmardtreatmentinpatientswithlongestablishedrheumatoidarthritis |