Cargando…
Allicin Alleviates Reticuloendotheliosis Virus-Induced Immunosuppression via ERK/Mitogen-Activated Protein Kinase Pathway in Specific Pathogen-Free Chickens
Reticuloendotheliosis virus (REV), a gammaretrovirus in the Retroviridae family, causes an immunosuppressive, oncogenic, and runting–stunting syndrome in multiple avian hosts. Allicin, the main effective component of garlic, has a broad spectrum of pharmacological properties. The hypothesis that all...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Frontiers Media S.A.
2017
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5744041/ https://www.ncbi.nlm.nih.gov/pubmed/29312337 http://dx.doi.org/10.3389/fimmu.2017.01856 |
_version_ | 1783288676639309824 |
---|---|
author | Wang, Liyuan Jiao, Hongchao Zhao, Jingpeng Wang, Xiaojuan Sun, Shuhong Lin, Hai |
author_facet | Wang, Liyuan Jiao, Hongchao Zhao, Jingpeng Wang, Xiaojuan Sun, Shuhong Lin, Hai |
author_sort | Wang, Liyuan |
collection | PubMed |
description | Reticuloendotheliosis virus (REV), a gammaretrovirus in the Retroviridae family, causes an immunosuppressive, oncogenic, and runting–stunting syndrome in multiple avian hosts. Allicin, the main effective component of garlic, has a broad spectrum of pharmacological properties. The hypothesis that allicin could relieve REV-induced immune dysfunction was investigated in vivo and in vitro in the present study. The results showed that dietary allicin supplementation ameliorated REV-induced dysplasia and immune dysfunction in REV-infected chickens. Compared with the control groups, REV infection promoted the expression of inflammatory cytokines including interleukin (IL)-1β, IL-6, IL-10, interferon (IFN)-γ, and tumor necrosis factor-α (TNF-α), whereas, allicin reversed these changes induced by REV infection. The decreased levels of IFN-α, IFN-β, and IL-2 were observed in REV-infected chickens, which were significantly improved by allicin. Allicin suppressed the REV-induced high expression of toll-like receptors (TLRs) as well as melanoma differentiation-associated gene 5 (MDA5) and the activation of mitogen-activated protein kinase (MAPK) and the nuclear factor kappa B p65. REV stimulated the phosphorylation of JNK, ERK, and p38, the downstream key signaling molecules of MAPK pathway, while allicin retarded the augmented phosphorylation level induced by REV infection. The decreased phosphorylation level of ERK was associated with REV replication, suggesting that ERK signaling is involved in REV replication, and allicin can alleviate the REV-induced immune dysfunction by inhibiting the activation of ERK. In addition, REV infection induced oxidative damage in thymus and spleen, whereas allicin treatment significantly decreased the oxidative stress induced by REV infection, suggesting that the antioxidant effect of allicin should be at least partially responsible for the harmful effect of REV infection. In conclusion, the findings suggest that allicin alleviates the inflammation and oxidative damage caused by REV infection and exerts the potential anti-REV effect by blocking the ERK/MAPK pathway. |
format | Online Article Text |
id | pubmed-5744041 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2017 |
publisher | Frontiers Media S.A. |
record_format | MEDLINE/PubMed |
spelling | pubmed-57440412018-01-08 Allicin Alleviates Reticuloendotheliosis Virus-Induced Immunosuppression via ERK/Mitogen-Activated Protein Kinase Pathway in Specific Pathogen-Free Chickens Wang, Liyuan Jiao, Hongchao Zhao, Jingpeng Wang, Xiaojuan Sun, Shuhong Lin, Hai Front Immunol Immunology Reticuloendotheliosis virus (REV), a gammaretrovirus in the Retroviridae family, causes an immunosuppressive, oncogenic, and runting–stunting syndrome in multiple avian hosts. Allicin, the main effective component of garlic, has a broad spectrum of pharmacological properties. The hypothesis that allicin could relieve REV-induced immune dysfunction was investigated in vivo and in vitro in the present study. The results showed that dietary allicin supplementation ameliorated REV-induced dysplasia and immune dysfunction in REV-infected chickens. Compared with the control groups, REV infection promoted the expression of inflammatory cytokines including interleukin (IL)-1β, IL-6, IL-10, interferon (IFN)-γ, and tumor necrosis factor-α (TNF-α), whereas, allicin reversed these changes induced by REV infection. The decreased levels of IFN-α, IFN-β, and IL-2 were observed in REV-infected chickens, which were significantly improved by allicin. Allicin suppressed the REV-induced high expression of toll-like receptors (TLRs) as well as melanoma differentiation-associated gene 5 (MDA5) and the activation of mitogen-activated protein kinase (MAPK) and the nuclear factor kappa B p65. REV stimulated the phosphorylation of JNK, ERK, and p38, the downstream key signaling molecules of MAPK pathway, while allicin retarded the augmented phosphorylation level induced by REV infection. The decreased phosphorylation level of ERK was associated with REV replication, suggesting that ERK signaling is involved in REV replication, and allicin can alleviate the REV-induced immune dysfunction by inhibiting the activation of ERK. In addition, REV infection induced oxidative damage in thymus and spleen, whereas allicin treatment significantly decreased the oxidative stress induced by REV infection, suggesting that the antioxidant effect of allicin should be at least partially responsible for the harmful effect of REV infection. In conclusion, the findings suggest that allicin alleviates the inflammation and oxidative damage caused by REV infection and exerts the potential anti-REV effect by blocking the ERK/MAPK pathway. Frontiers Media S.A. 2017-12-22 /pmc/articles/PMC5744041/ /pubmed/29312337 http://dx.doi.org/10.3389/fimmu.2017.01856 Text en Copyright © 2017 Wang, Jiao, Zhao, Wang, Sun and Lin. http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) or licensor are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms. |
spellingShingle | Immunology Wang, Liyuan Jiao, Hongchao Zhao, Jingpeng Wang, Xiaojuan Sun, Shuhong Lin, Hai Allicin Alleviates Reticuloendotheliosis Virus-Induced Immunosuppression via ERK/Mitogen-Activated Protein Kinase Pathway in Specific Pathogen-Free Chickens |
title | Allicin Alleviates Reticuloendotheliosis Virus-Induced Immunosuppression via ERK/Mitogen-Activated Protein Kinase Pathway in Specific Pathogen-Free Chickens |
title_full | Allicin Alleviates Reticuloendotheliosis Virus-Induced Immunosuppression via ERK/Mitogen-Activated Protein Kinase Pathway in Specific Pathogen-Free Chickens |
title_fullStr | Allicin Alleviates Reticuloendotheliosis Virus-Induced Immunosuppression via ERK/Mitogen-Activated Protein Kinase Pathway in Specific Pathogen-Free Chickens |
title_full_unstemmed | Allicin Alleviates Reticuloendotheliosis Virus-Induced Immunosuppression via ERK/Mitogen-Activated Protein Kinase Pathway in Specific Pathogen-Free Chickens |
title_short | Allicin Alleviates Reticuloendotheliosis Virus-Induced Immunosuppression via ERK/Mitogen-Activated Protein Kinase Pathway in Specific Pathogen-Free Chickens |
title_sort | allicin alleviates reticuloendotheliosis virus-induced immunosuppression via erk/mitogen-activated protein kinase pathway in specific pathogen-free chickens |
topic | Immunology |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5744041/ https://www.ncbi.nlm.nih.gov/pubmed/29312337 http://dx.doi.org/10.3389/fimmu.2017.01856 |
work_keys_str_mv | AT wangliyuan allicinalleviatesreticuloendotheliosisvirusinducedimmunosuppressionviaerkmitogenactivatedproteinkinasepathwayinspecificpathogenfreechickens AT jiaohongchao allicinalleviatesreticuloendotheliosisvirusinducedimmunosuppressionviaerkmitogenactivatedproteinkinasepathwayinspecificpathogenfreechickens AT zhaojingpeng allicinalleviatesreticuloendotheliosisvirusinducedimmunosuppressionviaerkmitogenactivatedproteinkinasepathwayinspecificpathogenfreechickens AT wangxiaojuan allicinalleviatesreticuloendotheliosisvirusinducedimmunosuppressionviaerkmitogenactivatedproteinkinasepathwayinspecificpathogenfreechickens AT sunshuhong allicinalleviatesreticuloendotheliosisvirusinducedimmunosuppressionviaerkmitogenactivatedproteinkinasepathwayinspecificpathogenfreechickens AT linhai allicinalleviatesreticuloendotheliosisvirusinducedimmunosuppressionviaerkmitogenactivatedproteinkinasepathwayinspecificpathogenfreechickens |