Cargando…

Do beneficiaries’ views matter in healthcare purchasing decisions? Experiences from the Nigerian tax-funded health system and the formal sector social health insurance program of the National Health Insurance Scheme

BACKGROUND: Purchasing is a health financing function that involves the transfer of pooled resources to providers on behalf of a covered population. Little attention has been paid to the extent to which the views of that population  are reflected in purchasing decisions. This article explores how pu...

Descripción completa

Detalles Bibliográficos
Autores principales: Ibe, Ogochukwu, Honda, Ayako, Etiaba, Enyi, Ezumah, Nkoli, Hanson, Kara, Onwujekwe, Obinna
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2017
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5745634/
https://www.ncbi.nlm.nih.gov/pubmed/29282087
http://dx.doi.org/10.1186/s12939-017-0711-y
_version_ 1783288940973785088
author Ibe, Ogochukwu
Honda, Ayako
Etiaba, Enyi
Ezumah, Nkoli
Hanson, Kara
Onwujekwe, Obinna
author_facet Ibe, Ogochukwu
Honda, Ayako
Etiaba, Enyi
Ezumah, Nkoli
Hanson, Kara
Onwujekwe, Obinna
author_sort Ibe, Ogochukwu
collection PubMed
description BACKGROUND: Purchasing is a health financing function that involves the transfer of pooled resources to providers on behalf of a covered population. Little attention has been paid to the extent to which the views of that population  are reflected in purchasing decisions. This article explores how purchasers in two financing mechanisms: the Formal Sector Social Health Insurance Programme (FSSHIP) operating under the Nigerian National Health Insurance Scheme (NHIS), and the tax-funded health system perform their roles in light of their responsibilities to the populations. METHODS: A case study approach was adopted in which each financing mechanism is a case. Sixteen (16) in-depth interviews with purchasers and eight (8) focus group discussions with beneficiaries were held. Agency and organizational behavioural theories were used to characterise the purchaser-citizen relationships. A deductive framework approach was used to assess whether actions identified in a model of ‘ideal’ strategic purchasing actions were undertaken in each case. RESULTS: For both cases, mechanisms exist to reflect people’s health needs in purchasing decisions, including quantitative and qualitative needs assessment, mechanisms to raise awareness of benefit entitlements and allow choice. However, purchasers do not use the mechanisms to effectively engage with and hold themselves accountable to the people. In the tax-funded system, weak information systems and unclear communication channels between the purchaser and citizens constrain assessment of needs; while timeliness of health information and poor engagement practices of Health Maintenance Organisations (HMOs) are the main constraints in FSSHIP. Inadequate information sharing in both mechanisms limits beneficiaries’ awareness of entitlements. Although beneficiaries of FSSHIP can choose providers, lack of information on the quality of services offered by providers constrains rational decision-making and the inability to change HMOs reduces HMO responsiveness to beneficiary needs. CONCLUSIONS: Responsiveness and accountability to beneficiaries are undervalued by purchasers in both financing mechanisms. In the tax-funded system, civil society organisations can facilitate engagement and accountability of purchasers and the people. In FSSHIP, NHIS needs to provide stronger stewardship of HMOs to promote effective engagement with members. Furthermore, the NHIS should introduce mechanisms that allow FSSHIP members to choose their own HMO, which could encourage HMOs to be more responsive to members.
format Online
Article
Text
id pubmed-5745634
institution National Center for Biotechnology Information
language English
publishDate 2017
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-57456342018-01-03 Do beneficiaries’ views matter in healthcare purchasing decisions? Experiences from the Nigerian tax-funded health system and the formal sector social health insurance program of the National Health Insurance Scheme Ibe, Ogochukwu Honda, Ayako Etiaba, Enyi Ezumah, Nkoli Hanson, Kara Onwujekwe, Obinna Int J Equity Health Research BACKGROUND: Purchasing is a health financing function that involves the transfer of pooled resources to providers on behalf of a covered population. Little attention has been paid to the extent to which the views of that population  are reflected in purchasing decisions. This article explores how purchasers in two financing mechanisms: the Formal Sector Social Health Insurance Programme (FSSHIP) operating under the Nigerian National Health Insurance Scheme (NHIS), and the tax-funded health system perform their roles in light of their responsibilities to the populations. METHODS: A case study approach was adopted in which each financing mechanism is a case. Sixteen (16) in-depth interviews with purchasers and eight (8) focus group discussions with beneficiaries were held. Agency and organizational behavioural theories were used to characterise the purchaser-citizen relationships. A deductive framework approach was used to assess whether actions identified in a model of ‘ideal’ strategic purchasing actions were undertaken in each case. RESULTS: For both cases, mechanisms exist to reflect people’s health needs in purchasing decisions, including quantitative and qualitative needs assessment, mechanisms to raise awareness of benefit entitlements and allow choice. However, purchasers do not use the mechanisms to effectively engage with and hold themselves accountable to the people. In the tax-funded system, weak information systems and unclear communication channels between the purchaser and citizens constrain assessment of needs; while timeliness of health information and poor engagement practices of Health Maintenance Organisations (HMOs) are the main constraints in FSSHIP. Inadequate information sharing in both mechanisms limits beneficiaries’ awareness of entitlements. Although beneficiaries of FSSHIP can choose providers, lack of information on the quality of services offered by providers constrains rational decision-making and the inability to change HMOs reduces HMO responsiveness to beneficiary needs. CONCLUSIONS: Responsiveness and accountability to beneficiaries are undervalued by purchasers in both financing mechanisms. In the tax-funded system, civil society organisations can facilitate engagement and accountability of purchasers and the people. In FSSHIP, NHIS needs to provide stronger stewardship of HMOs to promote effective engagement with members. Furthermore, the NHIS should introduce mechanisms that allow FSSHIP members to choose their own HMO, which could encourage HMOs to be more responsive to members. BioMed Central 2017-12-28 /pmc/articles/PMC5745634/ /pubmed/29282087 http://dx.doi.org/10.1186/s12939-017-0711-y Text en © The Author(s). 2017 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research
Ibe, Ogochukwu
Honda, Ayako
Etiaba, Enyi
Ezumah, Nkoli
Hanson, Kara
Onwujekwe, Obinna
Do beneficiaries’ views matter in healthcare purchasing decisions? Experiences from the Nigerian tax-funded health system and the formal sector social health insurance program of the National Health Insurance Scheme
title Do beneficiaries’ views matter in healthcare purchasing decisions? Experiences from the Nigerian tax-funded health system and the formal sector social health insurance program of the National Health Insurance Scheme
title_full Do beneficiaries’ views matter in healthcare purchasing decisions? Experiences from the Nigerian tax-funded health system and the formal sector social health insurance program of the National Health Insurance Scheme
title_fullStr Do beneficiaries’ views matter in healthcare purchasing decisions? Experiences from the Nigerian tax-funded health system and the formal sector social health insurance program of the National Health Insurance Scheme
title_full_unstemmed Do beneficiaries’ views matter in healthcare purchasing decisions? Experiences from the Nigerian tax-funded health system and the formal sector social health insurance program of the National Health Insurance Scheme
title_short Do beneficiaries’ views matter in healthcare purchasing decisions? Experiences from the Nigerian tax-funded health system and the formal sector social health insurance program of the National Health Insurance Scheme
title_sort do beneficiaries’ views matter in healthcare purchasing decisions? experiences from the nigerian tax-funded health system and the formal sector social health insurance program of the national health insurance scheme
topic Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5745634/
https://www.ncbi.nlm.nih.gov/pubmed/29282087
http://dx.doi.org/10.1186/s12939-017-0711-y
work_keys_str_mv AT ibeogochukwu dobeneficiariesviewsmatterinhealthcarepurchasingdecisionsexperiencesfromthenigeriantaxfundedhealthsystemandtheformalsectorsocialhealthinsuranceprogramofthenationalhealthinsurancescheme
AT hondaayako dobeneficiariesviewsmatterinhealthcarepurchasingdecisionsexperiencesfromthenigeriantaxfundedhealthsystemandtheformalsectorsocialhealthinsuranceprogramofthenationalhealthinsurancescheme
AT etiabaenyi dobeneficiariesviewsmatterinhealthcarepurchasingdecisionsexperiencesfromthenigeriantaxfundedhealthsystemandtheformalsectorsocialhealthinsuranceprogramofthenationalhealthinsurancescheme
AT ezumahnkoli dobeneficiariesviewsmatterinhealthcarepurchasingdecisionsexperiencesfromthenigeriantaxfundedhealthsystemandtheformalsectorsocialhealthinsuranceprogramofthenationalhealthinsurancescheme
AT hansonkara dobeneficiariesviewsmatterinhealthcarepurchasingdecisionsexperiencesfromthenigeriantaxfundedhealthsystemandtheformalsectorsocialhealthinsuranceprogramofthenationalhealthinsurancescheme
AT onwujekweobinna dobeneficiariesviewsmatterinhealthcarepurchasingdecisionsexperiencesfromthenigeriantaxfundedhealthsystemandtheformalsectorsocialhealthinsuranceprogramofthenationalhealthinsurancescheme