Cargando…

Streptococcus agalactiae infective endocarditis complicated by multiple mycotic hepatic aneurysms and massive splenic infarction: a case report

BACKGROUND: The burden of disease caused by Streptococcus agalactiae has increased significantly among older adults in the last decades. Group B streptococcus infection can be associated with invasive disease and severe clinical syndromes, such as meningitis and endocarditis. CASE PRESENTATION: We p...

Descripción completa

Detalles Bibliográficos
Autores principales: Achilli, Pietro, Guttadauro, Angelo, Bonfanti, Paolo, Terragni, Sabina, Fumagalli, Luca, Cioffi, Ugo, Gabrielli, Francesco, De Simone, Matilde, Chiarelli, Marco
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2017
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5747133/
https://www.ncbi.nlm.nih.gov/pubmed/29284415
http://dx.doi.org/10.1186/s12876-017-0728-0
_version_ 1783289227429019648
author Achilli, Pietro
Guttadauro, Angelo
Bonfanti, Paolo
Terragni, Sabina
Fumagalli, Luca
Cioffi, Ugo
Gabrielli, Francesco
De Simone, Matilde
Chiarelli, Marco
author_facet Achilli, Pietro
Guttadauro, Angelo
Bonfanti, Paolo
Terragni, Sabina
Fumagalli, Luca
Cioffi, Ugo
Gabrielli, Francesco
De Simone, Matilde
Chiarelli, Marco
author_sort Achilli, Pietro
collection PubMed
description BACKGROUND: The burden of disease caused by Streptococcus agalactiae has increased significantly among older adults in the last decades. Group B streptococcus infection can be associated with invasive disease and severe clinical syndromes, such as meningitis and endocarditis. CASE PRESENTATION: We present the case of a 56-year-old man who developed multiple mycotic aneurysms of the right hepatic artery and massive splenic infarction as rare complications of Streptococcus agalactiae infective endocarditis. The patient underwent urgent right hepatic artery ligation and splenectomy. The postoperative course was complicated by an episode of hemobilia due to the rupture of a partially thrombosed mycotic aneurysm into the biliary tree. Thus, selective radiological embolization of the left hepatic artery branches was necessary. CONCLUSION: To our knowledge, this is the first case reported of infected aneurysms of visceral arteries caused by Group B streptococcus infection. Clinical and laboratory findings were non-specific, while imaging features with computed tomography scan and angiography were highly suggestive. In our case, early recognition, culture-specific intravenous antibiotics and urgent surgical treatment combined with interventional radiology played a decisive role in the final result.
format Online
Article
Text
id pubmed-5747133
institution National Center for Biotechnology Information
language English
publishDate 2017
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-57471332018-01-03 Streptococcus agalactiae infective endocarditis complicated by multiple mycotic hepatic aneurysms and massive splenic infarction: a case report Achilli, Pietro Guttadauro, Angelo Bonfanti, Paolo Terragni, Sabina Fumagalli, Luca Cioffi, Ugo Gabrielli, Francesco De Simone, Matilde Chiarelli, Marco BMC Gastroenterol Case Report BACKGROUND: The burden of disease caused by Streptococcus agalactiae has increased significantly among older adults in the last decades. Group B streptococcus infection can be associated with invasive disease and severe clinical syndromes, such as meningitis and endocarditis. CASE PRESENTATION: We present the case of a 56-year-old man who developed multiple mycotic aneurysms of the right hepatic artery and massive splenic infarction as rare complications of Streptococcus agalactiae infective endocarditis. The patient underwent urgent right hepatic artery ligation and splenectomy. The postoperative course was complicated by an episode of hemobilia due to the rupture of a partially thrombosed mycotic aneurysm into the biliary tree. Thus, selective radiological embolization of the left hepatic artery branches was necessary. CONCLUSION: To our knowledge, this is the first case reported of infected aneurysms of visceral arteries caused by Group B streptococcus infection. Clinical and laboratory findings were non-specific, while imaging features with computed tomography scan and angiography were highly suggestive. In our case, early recognition, culture-specific intravenous antibiotics and urgent surgical treatment combined with interventional radiology played a decisive role in the final result. BioMed Central 2017-12-29 /pmc/articles/PMC5747133/ /pubmed/29284415 http://dx.doi.org/10.1186/s12876-017-0728-0 Text en © The Author(s). 2017 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Case Report
Achilli, Pietro
Guttadauro, Angelo
Bonfanti, Paolo
Terragni, Sabina
Fumagalli, Luca
Cioffi, Ugo
Gabrielli, Francesco
De Simone, Matilde
Chiarelli, Marco
Streptococcus agalactiae infective endocarditis complicated by multiple mycotic hepatic aneurysms and massive splenic infarction: a case report
title Streptococcus agalactiae infective endocarditis complicated by multiple mycotic hepatic aneurysms and massive splenic infarction: a case report
title_full Streptococcus agalactiae infective endocarditis complicated by multiple mycotic hepatic aneurysms and massive splenic infarction: a case report
title_fullStr Streptococcus agalactiae infective endocarditis complicated by multiple mycotic hepatic aneurysms and massive splenic infarction: a case report
title_full_unstemmed Streptococcus agalactiae infective endocarditis complicated by multiple mycotic hepatic aneurysms and massive splenic infarction: a case report
title_short Streptococcus agalactiae infective endocarditis complicated by multiple mycotic hepatic aneurysms and massive splenic infarction: a case report
title_sort streptococcus agalactiae infective endocarditis complicated by multiple mycotic hepatic aneurysms and massive splenic infarction: a case report
topic Case Report
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5747133/
https://www.ncbi.nlm.nih.gov/pubmed/29284415
http://dx.doi.org/10.1186/s12876-017-0728-0
work_keys_str_mv AT achillipietro streptococcusagalactiaeinfectiveendocarditiscomplicatedbymultiplemycotichepaticaneurysmsandmassivesplenicinfarctionacasereport
AT guttadauroangelo streptococcusagalactiaeinfectiveendocarditiscomplicatedbymultiplemycotichepaticaneurysmsandmassivesplenicinfarctionacasereport
AT bonfantipaolo streptococcusagalactiaeinfectiveendocarditiscomplicatedbymultiplemycotichepaticaneurysmsandmassivesplenicinfarctionacasereport
AT terragnisabina streptococcusagalactiaeinfectiveendocarditiscomplicatedbymultiplemycotichepaticaneurysmsandmassivesplenicinfarctionacasereport
AT fumagalliluca streptococcusagalactiaeinfectiveendocarditiscomplicatedbymultiplemycotichepaticaneurysmsandmassivesplenicinfarctionacasereport
AT cioffiugo streptococcusagalactiaeinfectiveendocarditiscomplicatedbymultiplemycotichepaticaneurysmsandmassivesplenicinfarctionacasereport
AT gabriellifrancesco streptococcusagalactiaeinfectiveendocarditiscomplicatedbymultiplemycotichepaticaneurysmsandmassivesplenicinfarctionacasereport
AT desimonematilde streptococcusagalactiaeinfectiveendocarditiscomplicatedbymultiplemycotichepaticaneurysmsandmassivesplenicinfarctionacasereport
AT chiarellimarco streptococcusagalactiaeinfectiveendocarditiscomplicatedbymultiplemycotichepaticaneurysmsandmassivesplenicinfarctionacasereport