Cargando…
Streptococcus agalactiae infective endocarditis complicated by multiple mycotic hepatic aneurysms and massive splenic infarction: a case report
BACKGROUND: The burden of disease caused by Streptococcus agalactiae has increased significantly among older adults in the last decades. Group B streptococcus infection can be associated with invasive disease and severe clinical syndromes, such as meningitis and endocarditis. CASE PRESENTATION: We p...
Autores principales: | , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2017
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5747133/ https://www.ncbi.nlm.nih.gov/pubmed/29284415 http://dx.doi.org/10.1186/s12876-017-0728-0 |
_version_ | 1783289227429019648 |
---|---|
author | Achilli, Pietro Guttadauro, Angelo Bonfanti, Paolo Terragni, Sabina Fumagalli, Luca Cioffi, Ugo Gabrielli, Francesco De Simone, Matilde Chiarelli, Marco |
author_facet | Achilli, Pietro Guttadauro, Angelo Bonfanti, Paolo Terragni, Sabina Fumagalli, Luca Cioffi, Ugo Gabrielli, Francesco De Simone, Matilde Chiarelli, Marco |
author_sort | Achilli, Pietro |
collection | PubMed |
description | BACKGROUND: The burden of disease caused by Streptococcus agalactiae has increased significantly among older adults in the last decades. Group B streptococcus infection can be associated with invasive disease and severe clinical syndromes, such as meningitis and endocarditis. CASE PRESENTATION: We present the case of a 56-year-old man who developed multiple mycotic aneurysms of the right hepatic artery and massive splenic infarction as rare complications of Streptococcus agalactiae infective endocarditis. The patient underwent urgent right hepatic artery ligation and splenectomy. The postoperative course was complicated by an episode of hemobilia due to the rupture of a partially thrombosed mycotic aneurysm into the biliary tree. Thus, selective radiological embolization of the left hepatic artery branches was necessary. CONCLUSION: To our knowledge, this is the first case reported of infected aneurysms of visceral arteries caused by Group B streptococcus infection. Clinical and laboratory findings were non-specific, while imaging features with computed tomography scan and angiography were highly suggestive. In our case, early recognition, culture-specific intravenous antibiotics and urgent surgical treatment combined with interventional radiology played a decisive role in the final result. |
format | Online Article Text |
id | pubmed-5747133 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2017 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-57471332018-01-03 Streptococcus agalactiae infective endocarditis complicated by multiple mycotic hepatic aneurysms and massive splenic infarction: a case report Achilli, Pietro Guttadauro, Angelo Bonfanti, Paolo Terragni, Sabina Fumagalli, Luca Cioffi, Ugo Gabrielli, Francesco De Simone, Matilde Chiarelli, Marco BMC Gastroenterol Case Report BACKGROUND: The burden of disease caused by Streptococcus agalactiae has increased significantly among older adults in the last decades. Group B streptococcus infection can be associated with invasive disease and severe clinical syndromes, such as meningitis and endocarditis. CASE PRESENTATION: We present the case of a 56-year-old man who developed multiple mycotic aneurysms of the right hepatic artery and massive splenic infarction as rare complications of Streptococcus agalactiae infective endocarditis. The patient underwent urgent right hepatic artery ligation and splenectomy. The postoperative course was complicated by an episode of hemobilia due to the rupture of a partially thrombosed mycotic aneurysm into the biliary tree. Thus, selective radiological embolization of the left hepatic artery branches was necessary. CONCLUSION: To our knowledge, this is the first case reported of infected aneurysms of visceral arteries caused by Group B streptococcus infection. Clinical and laboratory findings were non-specific, while imaging features with computed tomography scan and angiography were highly suggestive. In our case, early recognition, culture-specific intravenous antibiotics and urgent surgical treatment combined with interventional radiology played a decisive role in the final result. BioMed Central 2017-12-29 /pmc/articles/PMC5747133/ /pubmed/29284415 http://dx.doi.org/10.1186/s12876-017-0728-0 Text en © The Author(s). 2017 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Case Report Achilli, Pietro Guttadauro, Angelo Bonfanti, Paolo Terragni, Sabina Fumagalli, Luca Cioffi, Ugo Gabrielli, Francesco De Simone, Matilde Chiarelli, Marco Streptococcus agalactiae infective endocarditis complicated by multiple mycotic hepatic aneurysms and massive splenic infarction: a case report |
title | Streptococcus agalactiae infective endocarditis complicated by multiple mycotic hepatic aneurysms and massive splenic infarction: a case report |
title_full | Streptococcus agalactiae infective endocarditis complicated by multiple mycotic hepatic aneurysms and massive splenic infarction: a case report |
title_fullStr | Streptococcus agalactiae infective endocarditis complicated by multiple mycotic hepatic aneurysms and massive splenic infarction: a case report |
title_full_unstemmed | Streptococcus agalactiae infective endocarditis complicated by multiple mycotic hepatic aneurysms and massive splenic infarction: a case report |
title_short | Streptococcus agalactiae infective endocarditis complicated by multiple mycotic hepatic aneurysms and massive splenic infarction: a case report |
title_sort | streptococcus agalactiae infective endocarditis complicated by multiple mycotic hepatic aneurysms and massive splenic infarction: a case report |
topic | Case Report |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5747133/ https://www.ncbi.nlm.nih.gov/pubmed/29284415 http://dx.doi.org/10.1186/s12876-017-0728-0 |
work_keys_str_mv | AT achillipietro streptococcusagalactiaeinfectiveendocarditiscomplicatedbymultiplemycotichepaticaneurysmsandmassivesplenicinfarctionacasereport AT guttadauroangelo streptococcusagalactiaeinfectiveendocarditiscomplicatedbymultiplemycotichepaticaneurysmsandmassivesplenicinfarctionacasereport AT bonfantipaolo streptococcusagalactiaeinfectiveendocarditiscomplicatedbymultiplemycotichepaticaneurysmsandmassivesplenicinfarctionacasereport AT terragnisabina streptococcusagalactiaeinfectiveendocarditiscomplicatedbymultiplemycotichepaticaneurysmsandmassivesplenicinfarctionacasereport AT fumagalliluca streptococcusagalactiaeinfectiveendocarditiscomplicatedbymultiplemycotichepaticaneurysmsandmassivesplenicinfarctionacasereport AT cioffiugo streptococcusagalactiaeinfectiveendocarditiscomplicatedbymultiplemycotichepaticaneurysmsandmassivesplenicinfarctionacasereport AT gabriellifrancesco streptococcusagalactiaeinfectiveendocarditiscomplicatedbymultiplemycotichepaticaneurysmsandmassivesplenicinfarctionacasereport AT desimonematilde streptococcusagalactiaeinfectiveendocarditiscomplicatedbymultiplemycotichepaticaneurysmsandmassivesplenicinfarctionacasereport AT chiarellimarco streptococcusagalactiaeinfectiveendocarditiscomplicatedbymultiplemycotichepaticaneurysmsandmassivesplenicinfarctionacasereport |