Cargando…
Use of programme theory to understand the differential effects of interventions across socio-economic groups in systematic reviews—a systematic methodology review
BACKGROUND: Systematic review guidance recommends the use of programme theory to inform considerations of if and how healthcare interventions may work differently across socio-economic status (SES) groups. This study aimed to address the lack of detail on how reviewers operationalise this in practic...
Autores principales: | , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2017
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5747153/ https://www.ncbi.nlm.nih.gov/pubmed/29284538 http://dx.doi.org/10.1186/s13643-017-0638-9 |
_version_ | 1783289232227303424 |
---|---|
author | Maden, Michelle Cunliffe, Alex McMahon, Naoimh Booth, Andrew Carey, Gina Michelle Paisley, Suzy Dickson, Rumona Gabbay, Mark |
author_facet | Maden, Michelle Cunliffe, Alex McMahon, Naoimh Booth, Andrew Carey, Gina Michelle Paisley, Suzy Dickson, Rumona Gabbay, Mark |
author_sort | Maden, Michelle |
collection | PubMed |
description | BACKGROUND: Systematic review guidance recommends the use of programme theory to inform considerations of if and how healthcare interventions may work differently across socio-economic status (SES) groups. This study aimed to address the lack of detail on how reviewers operationalise this in practice. METHODS: A methodological systematic review was undertaken to assess if, how and the extent to which systematic reviewers operationalise the guidance on the use of programme theory in considerations of socio-economic inequalities in health. Multiple databases were searched from January 2013 to May 2016. Studies were included if they were systematic reviews assessing the effectiveness of an intervention and included data on SES. Two reviewers independently screened all studies, undertook quality assessment and extracted data. A narrative approach to synthesis was adopted. RESULTS: A total of 37 systematic reviews were included, 10 of which were explicit in the use of terminology for ‘programme theory’. Twenty-nine studies used programme theory to inform both their a priori assumptions and explain their review findings. Of these, 22 incorporated considerations of both what and how interventions do/do not work in SES groups to both predict and explain their review findings. Thirteen studies acknowledged 24 unique theoretical references to support their assumptions of what or how interventions may have different effects in SES groups. Most reviewers used supplementary evidence to support their considerations of differential effectiveness. The majority of authors outlined a programme theory in the “Introduction” and “Discussion” sections of the review to inform their assumptions or provide explanations of what or how interventions may result in differential effects within or across SES groups. About a third of reviews used programme theory to inform the review analysis and/or synthesis. Few authors used programme theory to inform their inclusion criteria, data extraction or quality assessment. Twenty-one studies tested their a priori programme theory. CONCLUSIONS: The use of programme theory to inform considerations of if, what and how interventions lead to differential effects on health in different SES groups in the systematic review process is not yet widely adopted, is used implicitly, is often fragmented and is not implemented in a systematic way. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s13643-017-0638-9) contains supplementary material, which is available to authorized users. |
format | Online Article Text |
id | pubmed-5747153 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2017 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-57471532018-01-03 Use of programme theory to understand the differential effects of interventions across socio-economic groups in systematic reviews—a systematic methodology review Maden, Michelle Cunliffe, Alex McMahon, Naoimh Booth, Andrew Carey, Gina Michelle Paisley, Suzy Dickson, Rumona Gabbay, Mark Syst Rev Research BACKGROUND: Systematic review guidance recommends the use of programme theory to inform considerations of if and how healthcare interventions may work differently across socio-economic status (SES) groups. This study aimed to address the lack of detail on how reviewers operationalise this in practice. METHODS: A methodological systematic review was undertaken to assess if, how and the extent to which systematic reviewers operationalise the guidance on the use of programme theory in considerations of socio-economic inequalities in health. Multiple databases were searched from January 2013 to May 2016. Studies were included if they were systematic reviews assessing the effectiveness of an intervention and included data on SES. Two reviewers independently screened all studies, undertook quality assessment and extracted data. A narrative approach to synthesis was adopted. RESULTS: A total of 37 systematic reviews were included, 10 of which were explicit in the use of terminology for ‘programme theory’. Twenty-nine studies used programme theory to inform both their a priori assumptions and explain their review findings. Of these, 22 incorporated considerations of both what and how interventions do/do not work in SES groups to both predict and explain their review findings. Thirteen studies acknowledged 24 unique theoretical references to support their assumptions of what or how interventions may have different effects in SES groups. Most reviewers used supplementary evidence to support their considerations of differential effectiveness. The majority of authors outlined a programme theory in the “Introduction” and “Discussion” sections of the review to inform their assumptions or provide explanations of what or how interventions may result in differential effects within or across SES groups. About a third of reviews used programme theory to inform the review analysis and/or synthesis. Few authors used programme theory to inform their inclusion criteria, data extraction or quality assessment. Twenty-one studies tested their a priori programme theory. CONCLUSIONS: The use of programme theory to inform considerations of if, what and how interventions lead to differential effects on health in different SES groups in the systematic review process is not yet widely adopted, is used implicitly, is often fragmented and is not implemented in a systematic way. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s13643-017-0638-9) contains supplementary material, which is available to authorized users. BioMed Central 2017-12-29 /pmc/articles/PMC5747153/ /pubmed/29284538 http://dx.doi.org/10.1186/s13643-017-0638-9 Text en © The Author(s). 2017 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Maden, Michelle Cunliffe, Alex McMahon, Naoimh Booth, Andrew Carey, Gina Michelle Paisley, Suzy Dickson, Rumona Gabbay, Mark Use of programme theory to understand the differential effects of interventions across socio-economic groups in systematic reviews—a systematic methodology review |
title | Use of programme theory to understand the differential effects of interventions across socio-economic groups in systematic reviews—a systematic methodology review |
title_full | Use of programme theory to understand the differential effects of interventions across socio-economic groups in systematic reviews—a systematic methodology review |
title_fullStr | Use of programme theory to understand the differential effects of interventions across socio-economic groups in systematic reviews—a systematic methodology review |
title_full_unstemmed | Use of programme theory to understand the differential effects of interventions across socio-economic groups in systematic reviews—a systematic methodology review |
title_short | Use of programme theory to understand the differential effects of interventions across socio-economic groups in systematic reviews—a systematic methodology review |
title_sort | use of programme theory to understand the differential effects of interventions across socio-economic groups in systematic reviews—a systematic methodology review |
topic | Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5747153/ https://www.ncbi.nlm.nih.gov/pubmed/29284538 http://dx.doi.org/10.1186/s13643-017-0638-9 |
work_keys_str_mv | AT madenmichelle useofprogrammetheorytounderstandthedifferentialeffectsofinterventionsacrosssocioeconomicgroupsinsystematicreviewsasystematicmethodologyreview AT cunliffealex useofprogrammetheorytounderstandthedifferentialeffectsofinterventionsacrosssocioeconomicgroupsinsystematicreviewsasystematicmethodologyreview AT mcmahonnaoimh useofprogrammetheorytounderstandthedifferentialeffectsofinterventionsacrosssocioeconomicgroupsinsystematicreviewsasystematicmethodologyreview AT boothandrew useofprogrammetheorytounderstandthedifferentialeffectsofinterventionsacrosssocioeconomicgroupsinsystematicreviewsasystematicmethodologyreview AT careyginamichelle useofprogrammetheorytounderstandthedifferentialeffectsofinterventionsacrosssocioeconomicgroupsinsystematicreviewsasystematicmethodologyreview AT paisleysuzy useofprogrammetheorytounderstandthedifferentialeffectsofinterventionsacrosssocioeconomicgroupsinsystematicreviewsasystematicmethodologyreview AT dicksonrumona useofprogrammetheorytounderstandthedifferentialeffectsofinterventionsacrosssocioeconomicgroupsinsystematicreviewsasystematicmethodologyreview AT gabbaymark useofprogrammetheorytounderstandthedifferentialeffectsofinterventionsacrosssocioeconomicgroupsinsystematicreviewsasystematicmethodologyreview |