Update: Providing Quality Family Planning Services — Recommendations from CDC and the U.S. Office of Population Affairs, 2017

Detalles Bibliográficos
Autores principales: Gavin, Loretta, Pazol, Karen, Ahrens, Katherine
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Centers for Disease Control and Prevention 2017
Materias:
Full Report
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5751580/
https://www.ncbi.nlm.nih.gov/pubmed/29267259
http://dx.doi.org/10.15585/mmwr.mm6650a4
_version_ 1783289976557928448
author Gavin, Loretta
Pazol, Karen
Ahrens, Katherine
author_facet Gavin, Loretta
Pazol, Karen
Ahrens, Katherine
author_sort Gavin, Loretta
collection PubMed
description
format Online
Article
Text
id pubmed-5751580
institution National Center for Biotechnology Information
language English
publishDate 2017
publisher Centers for Disease Control and Prevention
record_format MEDLINE/PubMed
spelling pubmed-57515802018-01-17 Update: Providing Quality Family Planning Services — Recommendations from CDC and the U.S. Office of Population Affairs, 2017 Gavin, Loretta Pazol, Karen Ahrens, Katherine MMWR Morb Mortal Wkly Rep Full Report Centers for Disease Control and Prevention 2017-12-22 /pmc/articles/PMC5751580/ /pubmed/29267259 http://dx.doi.org/10.15585/mmwr.mm6650a4 Text en https://creativecommons.org/licenses/by/3.0/All material in the MMWR Series is in the public domain and may be used and reprinted without permission; citation as to source, however, is appreciated.
spellingShingle Full Report
Gavin, Loretta
Pazol, Karen
Ahrens, Katherine
Update: Providing Quality Family Planning Services — Recommendations from CDC and the U.S. Office of Population Affairs, 2017
title Update: Providing Quality Family Planning Services — Recommendations from CDC and the U.S. Office of Population Affairs, 2017
title_full Update: Providing Quality Family Planning Services — Recommendations from CDC and the U.S. Office of Population Affairs, 2017
title_fullStr Update: Providing Quality Family Planning Services — Recommendations from CDC and the U.S. Office of Population Affairs, 2017
title_full_unstemmed Update: Providing Quality Family Planning Services — Recommendations from CDC and the U.S. Office of Population Affairs, 2017
title_short Update: Providing Quality Family Planning Services — Recommendations from CDC and the U.S. Office of Population Affairs, 2017
title_sort update: providing quality family planning services — recommendations from cdc and the u.s. office of population affairs, 2017
topic Full Report
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5751580/
https://www.ncbi.nlm.nih.gov/pubmed/29267259
http://dx.doi.org/10.15585/mmwr.mm6650a4
work_keys_str_mv AT gavinloretta updateprovidingqualityfamilyplanningservicesrecommendationsfromcdcandtheusofficeofpopulationaffairs2017
AT pazolkaren updateprovidingqualityfamilyplanningservicesrecommendationsfromcdcandtheusofficeofpopulationaffairs2017
AT ahrenskatherine updateprovidingqualityfamilyplanningservicesrecommendationsfromcdcandtheusofficeofpopulationaffairs2017

Ejemplares similares