Cargando…

Effectiveness and safety of ferric carboxymaltose compared to iron sucrose in women with iron deficiency anemia: phase IV clinical trials

BACKGROUND: Iron deficiency anemia (IDA) is a significant problem worldwide particularly in women. The aim of the study was to evaluate the effectiveness and safety of intravenous ferric carboxymaltose (FCM) in comparison to iron sucrose (IS) in women with IDA. METHOD: Two hundred patients at Depart...

Descripción completa

Detalles Bibliográficos
Autores principales: Naqash, Amreen, Ara, Rifat, Bader, Ghulam N.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2018
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5755312/
https://www.ncbi.nlm.nih.gov/pubmed/29304848
http://dx.doi.org/10.1186/s12905-017-0506-8
_version_ 1783290571656265728
author Naqash, Amreen
Ara, Rifat
Bader, Ghulam N.
author_facet Naqash, Amreen
Ara, Rifat
Bader, Ghulam N.
author_sort Naqash, Amreen
collection PubMed
description BACKGROUND: Iron deficiency anemia (IDA) is a significant problem worldwide particularly in women. The aim of the study was to evaluate the effectiveness and safety of intravenous ferric carboxymaltose (FCM) in comparison to iron sucrose (IS) in women with IDA. METHOD: Two hundred patients at Department of Obstetrics and Gynaecology, Sher-i-Kashmir Institute of Medical Sciences Medical College and Hospital, Jammu & Kashmir, India identified with IDA were enrolled for the study. Intravenous FCM and IS were both given as per the protocol. Change in the laboratory parameters such as hemoglobin (Hb), mean corpuscular value, and serum ferritin levels at two weeks and four weeks interval after the treatment was recorded. RESULT: A significant increase in the mean Hb was observed from 7.76 ± 0.709 to 13.25 ± 0.606 in patients treated with FCM and 7.64 ± 0.710 to 11.59 ± 0.733 g/dL (P < 0.001) in patients treated with IS after four weeks of therapy. The rise in mean corpuscular volume was from 66.82 ± 5.24 to 86.76 ± 3.765 and 68.05 ± 5.56 to 93.80 ± 3.80 and rise in serum ferritin levels were from 8.32 ± 1.787 to 38.94 ± 6.095 μg/L and 8.16 ± 1.540 to 27 ± 8.175 μg/L in patients treated with FCM and IS respectively after four weeks of therapy. No serious adverse effects were reported. CONCLUSION: Parenteral therapy is effective in IDA, but FCM elevates hemoglobin level and restored iron stores faster than IS with minimum adverse drug reactions. TRIAL REGISTRATION NUMBER: ISRCTN14484575 Dated: 15–12-2017 retrospectively registered. https://doi.org/10.1186/ISRCTN14484575
format Online
Article
Text
id pubmed-5755312
institution National Center for Biotechnology Information
language English
publishDate 2018
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-57553122018-01-08 Effectiveness and safety of ferric carboxymaltose compared to iron sucrose in women with iron deficiency anemia: phase IV clinical trials Naqash, Amreen Ara, Rifat Bader, Ghulam N. BMC Womens Health Research Article BACKGROUND: Iron deficiency anemia (IDA) is a significant problem worldwide particularly in women. The aim of the study was to evaluate the effectiveness and safety of intravenous ferric carboxymaltose (FCM) in comparison to iron sucrose (IS) in women with IDA. METHOD: Two hundred patients at Department of Obstetrics and Gynaecology, Sher-i-Kashmir Institute of Medical Sciences Medical College and Hospital, Jammu & Kashmir, India identified with IDA were enrolled for the study. Intravenous FCM and IS were both given as per the protocol. Change in the laboratory parameters such as hemoglobin (Hb), mean corpuscular value, and serum ferritin levels at two weeks and four weeks interval after the treatment was recorded. RESULT: A significant increase in the mean Hb was observed from 7.76 ± 0.709 to 13.25 ± 0.606 in patients treated with FCM and 7.64 ± 0.710 to 11.59 ± 0.733 g/dL (P < 0.001) in patients treated with IS after four weeks of therapy. The rise in mean corpuscular volume was from 66.82 ± 5.24 to 86.76 ± 3.765 and 68.05 ± 5.56 to 93.80 ± 3.80 and rise in serum ferritin levels were from 8.32 ± 1.787 to 38.94 ± 6.095 μg/L and 8.16 ± 1.540 to 27 ± 8.175 μg/L in patients treated with FCM and IS respectively after four weeks of therapy. No serious adverse effects were reported. CONCLUSION: Parenteral therapy is effective in IDA, but FCM elevates hemoglobin level and restored iron stores faster than IS with minimum adverse drug reactions. TRIAL REGISTRATION NUMBER: ISRCTN14484575 Dated: 15–12-2017 retrospectively registered. https://doi.org/10.1186/ISRCTN14484575 BioMed Central 2018-01-05 /pmc/articles/PMC5755312/ /pubmed/29304848 http://dx.doi.org/10.1186/s12905-017-0506-8 Text en © The Author(s) 2018 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research Article
Naqash, Amreen
Ara, Rifat
Bader, Ghulam N.
Effectiveness and safety of ferric carboxymaltose compared to iron sucrose in women with iron deficiency anemia: phase IV clinical trials
title Effectiveness and safety of ferric carboxymaltose compared to iron sucrose in women with iron deficiency anemia: phase IV clinical trials
title_full Effectiveness and safety of ferric carboxymaltose compared to iron sucrose in women with iron deficiency anemia: phase IV clinical trials
title_fullStr Effectiveness and safety of ferric carboxymaltose compared to iron sucrose in women with iron deficiency anemia: phase IV clinical trials
title_full_unstemmed Effectiveness and safety of ferric carboxymaltose compared to iron sucrose in women with iron deficiency anemia: phase IV clinical trials
title_short Effectiveness and safety of ferric carboxymaltose compared to iron sucrose in women with iron deficiency anemia: phase IV clinical trials
title_sort effectiveness and safety of ferric carboxymaltose compared to iron sucrose in women with iron deficiency anemia: phase iv clinical trials
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5755312/
https://www.ncbi.nlm.nih.gov/pubmed/29304848
http://dx.doi.org/10.1186/s12905-017-0506-8
work_keys_str_mv AT naqashamreen effectivenessandsafetyofferriccarboxymaltosecomparedtoironsucroseinwomenwithirondeficiencyanemiaphaseivclinicaltrials
AT ararifat effectivenessandsafetyofferriccarboxymaltosecomparedtoironsucroseinwomenwithirondeficiencyanemiaphaseivclinicaltrials
AT baderghulamn effectivenessandsafetyofferriccarboxymaltosecomparedtoironsucroseinwomenwithirondeficiencyanemiaphaseivclinicaltrials