Cargando…
Discovery of a highly selective KIT kinase primary V559D mutant inhibitor for gastrointestinal stromal tumors (GISTs)
KIT kinase V559D mutation is the most prevalent primary gain-of-function mutation in Gastrointestinal Stromal Tumors (GISTs). Here we reported a highly selective KIT V559D inhibitor CHMFL-KIT-031, which displayed about 10-20 fold selectivity over KIT wt in the biochemical assay (IC(50): 28 nM over 1...
Autores principales: | , , , , , , , , , , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Impact Journals LLC
2017
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5762309/ https://www.ncbi.nlm.nih.gov/pubmed/29340041 http://dx.doi.org/10.18632/oncotarget.22624 |
_version_ | 1783291658066984960 |
---|---|
author | Yu, Kailin Liu, Xuesong Jiang, Zongru Hu, Chen Zou, Fengming Chen, Cheng Ge, Juan Wu, Jiaxin Liu, Xiaochuan Wang, Aoli Wang, Wenliang Wang, Wenchao Qi, Ziping Wang, Beilei Wang, Li Yan, Hezhong Wang, Jiaoxue Ren, Tao Tang, Jun Liu, Qingsong Liu, Jing |
author_facet | Yu, Kailin Liu, Xuesong Jiang, Zongru Hu, Chen Zou, Fengming Chen, Cheng Ge, Juan Wu, Jiaxin Liu, Xiaochuan Wang, Aoli Wang, Wenliang Wang, Wenchao Qi, Ziping Wang, Beilei Wang, Li Yan, Hezhong Wang, Jiaoxue Ren, Tao Tang, Jun Liu, Qingsong Liu, Jing |
author_sort | Yu, Kailin |
collection | PubMed |
description | KIT kinase V559D mutation is the most prevalent primary gain-of-function mutation in Gastrointestinal Stromal Tumors (GISTs). Here we reported a highly selective KIT V559D inhibitor CHMFL-KIT-031, which displayed about 10-20 fold selectivity over KIT wt in the biochemical assay (IC(50): 28 nM over 168 nM; Kd: 266 nM versus 6640 nM) and in cell (EC(50): 176 nM versus 2000 nM for pY703) examination. It also displayed 15∼400-fold selectivity over other primary mutants such as L576P and secondary mutants including T670I, V654A (ATP binding pocket) as well as N822K and D816V (activation loop). In addition, it exhibited a selectivity S score (1) of 0.01 among 468 kinases/mutants in the KINOMEScan(™) assay. CHMFL-KIT-031 showed potent inhibitory efficacy for KIT V559D mediated signaling pathways in cell and anti-tumor activity in vivo (Tumor Growth Inhibition: 68.5%). Its superior selectivity would make it a good pharmacological tool for further dissection of KIT V559D mediated pathology in the GISTs. |
format | Online Article Text |
id | pubmed-5762309 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2017 |
publisher | Impact Journals LLC |
record_format | MEDLINE/PubMed |
spelling | pubmed-57623092018-01-16 Discovery of a highly selective KIT kinase primary V559D mutant inhibitor for gastrointestinal stromal tumors (GISTs) Yu, Kailin Liu, Xuesong Jiang, Zongru Hu, Chen Zou, Fengming Chen, Cheng Ge, Juan Wu, Jiaxin Liu, Xiaochuan Wang, Aoli Wang, Wenliang Wang, Wenchao Qi, Ziping Wang, Beilei Wang, Li Yan, Hezhong Wang, Jiaoxue Ren, Tao Tang, Jun Liu, Qingsong Liu, Jing Oncotarget Research Paper KIT kinase V559D mutation is the most prevalent primary gain-of-function mutation in Gastrointestinal Stromal Tumors (GISTs). Here we reported a highly selective KIT V559D inhibitor CHMFL-KIT-031, which displayed about 10-20 fold selectivity over KIT wt in the biochemical assay (IC(50): 28 nM over 168 nM; Kd: 266 nM versus 6640 nM) and in cell (EC(50): 176 nM versus 2000 nM for pY703) examination. It also displayed 15∼400-fold selectivity over other primary mutants such as L576P and secondary mutants including T670I, V654A (ATP binding pocket) as well as N822K and D816V (activation loop). In addition, it exhibited a selectivity S score (1) of 0.01 among 468 kinases/mutants in the KINOMEScan(™) assay. CHMFL-KIT-031 showed potent inhibitory efficacy for KIT V559D mediated signaling pathways in cell and anti-tumor activity in vivo (Tumor Growth Inhibition: 68.5%). Its superior selectivity would make it a good pharmacological tool for further dissection of KIT V559D mediated pathology in the GISTs. Impact Journals LLC 2017-11-15 /pmc/articles/PMC5762309/ /pubmed/29340041 http://dx.doi.org/10.18632/oncotarget.22624 Text en Copyright: © 2017 Yu et al. http://creativecommons.org/licenses/by/3.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/3.0/) 3.0 (CC BY 3.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited. |
spellingShingle | Research Paper Yu, Kailin Liu, Xuesong Jiang, Zongru Hu, Chen Zou, Fengming Chen, Cheng Ge, Juan Wu, Jiaxin Liu, Xiaochuan Wang, Aoli Wang, Wenliang Wang, Wenchao Qi, Ziping Wang, Beilei Wang, Li Yan, Hezhong Wang, Jiaoxue Ren, Tao Tang, Jun Liu, Qingsong Liu, Jing Discovery of a highly selective KIT kinase primary V559D mutant inhibitor for gastrointestinal stromal tumors (GISTs) |
title | Discovery of a highly selective KIT kinase primary V559D mutant inhibitor for gastrointestinal stromal tumors (GISTs) |
title_full | Discovery of a highly selective KIT kinase primary V559D mutant inhibitor for gastrointestinal stromal tumors (GISTs) |
title_fullStr | Discovery of a highly selective KIT kinase primary V559D mutant inhibitor for gastrointestinal stromal tumors (GISTs) |
title_full_unstemmed | Discovery of a highly selective KIT kinase primary V559D mutant inhibitor for gastrointestinal stromal tumors (GISTs) |
title_short | Discovery of a highly selective KIT kinase primary V559D mutant inhibitor for gastrointestinal stromal tumors (GISTs) |
title_sort | discovery of a highly selective kit kinase primary v559d mutant inhibitor for gastrointestinal stromal tumors (gists) |
topic | Research Paper |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5762309/ https://www.ncbi.nlm.nih.gov/pubmed/29340041 http://dx.doi.org/10.18632/oncotarget.22624 |
work_keys_str_mv | AT yukailin discoveryofahighlyselectivekitkinaseprimaryv559dmutantinhibitorforgastrointestinalstromaltumorsgists AT liuxuesong discoveryofahighlyselectivekitkinaseprimaryv559dmutantinhibitorforgastrointestinalstromaltumorsgists AT jiangzongru discoveryofahighlyselectivekitkinaseprimaryv559dmutantinhibitorforgastrointestinalstromaltumorsgists AT huchen discoveryofahighlyselectivekitkinaseprimaryv559dmutantinhibitorforgastrointestinalstromaltumorsgists AT zoufengming discoveryofahighlyselectivekitkinaseprimaryv559dmutantinhibitorforgastrointestinalstromaltumorsgists AT chencheng discoveryofahighlyselectivekitkinaseprimaryv559dmutantinhibitorforgastrointestinalstromaltumorsgists AT gejuan discoveryofahighlyselectivekitkinaseprimaryv559dmutantinhibitorforgastrointestinalstromaltumorsgists AT wujiaxin discoveryofahighlyselectivekitkinaseprimaryv559dmutantinhibitorforgastrointestinalstromaltumorsgists AT liuxiaochuan discoveryofahighlyselectivekitkinaseprimaryv559dmutantinhibitorforgastrointestinalstromaltumorsgists AT wangaoli discoveryofahighlyselectivekitkinaseprimaryv559dmutantinhibitorforgastrointestinalstromaltumorsgists AT wangwenliang discoveryofahighlyselectivekitkinaseprimaryv559dmutantinhibitorforgastrointestinalstromaltumorsgists AT wangwenchao discoveryofahighlyselectivekitkinaseprimaryv559dmutantinhibitorforgastrointestinalstromaltumorsgists AT qiziping discoveryofahighlyselectivekitkinaseprimaryv559dmutantinhibitorforgastrointestinalstromaltumorsgists AT wangbeilei discoveryofahighlyselectivekitkinaseprimaryv559dmutantinhibitorforgastrointestinalstromaltumorsgists AT wangli discoveryofahighlyselectivekitkinaseprimaryv559dmutantinhibitorforgastrointestinalstromaltumorsgists AT yanhezhong discoveryofahighlyselectivekitkinaseprimaryv559dmutantinhibitorforgastrointestinalstromaltumorsgists AT wangjiaoxue discoveryofahighlyselectivekitkinaseprimaryv559dmutantinhibitorforgastrointestinalstromaltumorsgists AT rentao discoveryofahighlyselectivekitkinaseprimaryv559dmutantinhibitorforgastrointestinalstromaltumorsgists AT tangjun discoveryofahighlyselectivekitkinaseprimaryv559dmutantinhibitorforgastrointestinalstromaltumorsgists AT liuqingsong discoveryofahighlyselectivekitkinaseprimaryv559dmutantinhibitorforgastrointestinalstromaltumorsgists AT liujing discoveryofahighlyselectivekitkinaseprimaryv559dmutantinhibitorforgastrointestinalstromaltumorsgists |