Cargando…

Discovery of a highly selective KIT kinase primary V559D mutant inhibitor for gastrointestinal stromal tumors (GISTs)

KIT kinase V559D mutation is the most prevalent primary gain-of-function mutation in Gastrointestinal Stromal Tumors (GISTs). Here we reported a highly selective KIT V559D inhibitor CHMFL-KIT-031, which displayed about 10-20 fold selectivity over KIT wt in the biochemical assay (IC(50): 28 nM over 1...

Descripción completa

Detalles Bibliográficos
Autores principales: Yu, Kailin, Liu, Xuesong, Jiang, Zongru, Hu, Chen, Zou, Fengming, Chen, Cheng, Ge, Juan, Wu, Jiaxin, Liu, Xiaochuan, Wang, Aoli, Wang, Wenliang, Wang, Wenchao, Qi, Ziping, Wang, Beilei, Wang, Li, Yan, Hezhong, Wang, Jiaoxue, Ren, Tao, Tang, Jun, Liu, Qingsong, Liu, Jing
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Impact Journals LLC 2017
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5762309/
https://www.ncbi.nlm.nih.gov/pubmed/29340041
http://dx.doi.org/10.18632/oncotarget.22624
_version_ 1783291658066984960
author Yu, Kailin
Liu, Xuesong
Jiang, Zongru
Hu, Chen
Zou, Fengming
Chen, Cheng
Ge, Juan
Wu, Jiaxin
Liu, Xiaochuan
Wang, Aoli
Wang, Wenliang
Wang, Wenchao
Qi, Ziping
Wang, Beilei
Wang, Li
Yan, Hezhong
Wang, Jiaoxue
Ren, Tao
Tang, Jun
Liu, Qingsong
Liu, Jing
author_facet Yu, Kailin
Liu, Xuesong
Jiang, Zongru
Hu, Chen
Zou, Fengming
Chen, Cheng
Ge, Juan
Wu, Jiaxin
Liu, Xiaochuan
Wang, Aoli
Wang, Wenliang
Wang, Wenchao
Qi, Ziping
Wang, Beilei
Wang, Li
Yan, Hezhong
Wang, Jiaoxue
Ren, Tao
Tang, Jun
Liu, Qingsong
Liu, Jing
author_sort Yu, Kailin
collection PubMed
description KIT kinase V559D mutation is the most prevalent primary gain-of-function mutation in Gastrointestinal Stromal Tumors (GISTs). Here we reported a highly selective KIT V559D inhibitor CHMFL-KIT-031, which displayed about 10-20 fold selectivity over KIT wt in the biochemical assay (IC(50): 28 nM over 168 nM; Kd: 266 nM versus 6640 nM) and in cell (EC(50): 176 nM versus 2000 nM for pY703) examination. It also displayed 15∼400-fold selectivity over other primary mutants such as L576P and secondary mutants including T670I, V654A (ATP binding pocket) as well as N822K and D816V (activation loop). In addition, it exhibited a selectivity S score (1) of 0.01 among 468 kinases/mutants in the KINOMEScan(™) assay. CHMFL-KIT-031 showed potent inhibitory efficacy for KIT V559D mediated signaling pathways in cell and anti-tumor activity in vivo (Tumor Growth Inhibition: 68.5%). Its superior selectivity would make it a good pharmacological tool for further dissection of KIT V559D mediated pathology in the GISTs.
format Online
Article
Text
id pubmed-5762309
institution National Center for Biotechnology Information
language English
publishDate 2017
publisher Impact Journals LLC
record_format MEDLINE/PubMed
spelling pubmed-57623092018-01-16 Discovery of a highly selective KIT kinase primary V559D mutant inhibitor for gastrointestinal stromal tumors (GISTs) Yu, Kailin Liu, Xuesong Jiang, Zongru Hu, Chen Zou, Fengming Chen, Cheng Ge, Juan Wu, Jiaxin Liu, Xiaochuan Wang, Aoli Wang, Wenliang Wang, Wenchao Qi, Ziping Wang, Beilei Wang, Li Yan, Hezhong Wang, Jiaoxue Ren, Tao Tang, Jun Liu, Qingsong Liu, Jing Oncotarget Research Paper KIT kinase V559D mutation is the most prevalent primary gain-of-function mutation in Gastrointestinal Stromal Tumors (GISTs). Here we reported a highly selective KIT V559D inhibitor CHMFL-KIT-031, which displayed about 10-20 fold selectivity over KIT wt in the biochemical assay (IC(50): 28 nM over 168 nM; Kd: 266 nM versus 6640 nM) and in cell (EC(50): 176 nM versus 2000 nM for pY703) examination. It also displayed 15∼400-fold selectivity over other primary mutants such as L576P and secondary mutants including T670I, V654A (ATP binding pocket) as well as N822K and D816V (activation loop). In addition, it exhibited a selectivity S score (1) of 0.01 among 468 kinases/mutants in the KINOMEScan(™) assay. CHMFL-KIT-031 showed potent inhibitory efficacy for KIT V559D mediated signaling pathways in cell and anti-tumor activity in vivo (Tumor Growth Inhibition: 68.5%). Its superior selectivity would make it a good pharmacological tool for further dissection of KIT V559D mediated pathology in the GISTs. Impact Journals LLC 2017-11-15 /pmc/articles/PMC5762309/ /pubmed/29340041 http://dx.doi.org/10.18632/oncotarget.22624 Text en Copyright: © 2017 Yu et al. http://creativecommons.org/licenses/by/3.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/3.0/) 3.0 (CC BY 3.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited.
spellingShingle Research Paper
Yu, Kailin
Liu, Xuesong
Jiang, Zongru
Hu, Chen
Zou, Fengming
Chen, Cheng
Ge, Juan
Wu, Jiaxin
Liu, Xiaochuan
Wang, Aoli
Wang, Wenliang
Wang, Wenchao
Qi, Ziping
Wang, Beilei
Wang, Li
Yan, Hezhong
Wang, Jiaoxue
Ren, Tao
Tang, Jun
Liu, Qingsong
Liu, Jing
Discovery of a highly selective KIT kinase primary V559D mutant inhibitor for gastrointestinal stromal tumors (GISTs)
title Discovery of a highly selective KIT kinase primary V559D mutant inhibitor for gastrointestinal stromal tumors (GISTs)
title_full Discovery of a highly selective KIT kinase primary V559D mutant inhibitor for gastrointestinal stromal tumors (GISTs)
title_fullStr Discovery of a highly selective KIT kinase primary V559D mutant inhibitor for gastrointestinal stromal tumors (GISTs)
title_full_unstemmed Discovery of a highly selective KIT kinase primary V559D mutant inhibitor for gastrointestinal stromal tumors (GISTs)
title_short Discovery of a highly selective KIT kinase primary V559D mutant inhibitor for gastrointestinal stromal tumors (GISTs)
title_sort discovery of a highly selective kit kinase primary v559d mutant inhibitor for gastrointestinal stromal tumors (gists)
topic Research Paper
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5762309/
https://www.ncbi.nlm.nih.gov/pubmed/29340041
http://dx.doi.org/10.18632/oncotarget.22624
work_keys_str_mv AT yukailin discoveryofahighlyselectivekitkinaseprimaryv559dmutantinhibitorforgastrointestinalstromaltumorsgists
AT liuxuesong discoveryofahighlyselectivekitkinaseprimaryv559dmutantinhibitorforgastrointestinalstromaltumorsgists
AT jiangzongru discoveryofahighlyselectivekitkinaseprimaryv559dmutantinhibitorforgastrointestinalstromaltumorsgists
AT huchen discoveryofahighlyselectivekitkinaseprimaryv559dmutantinhibitorforgastrointestinalstromaltumorsgists
AT zoufengming discoveryofahighlyselectivekitkinaseprimaryv559dmutantinhibitorforgastrointestinalstromaltumorsgists
AT chencheng discoveryofahighlyselectivekitkinaseprimaryv559dmutantinhibitorforgastrointestinalstromaltumorsgists
AT gejuan discoveryofahighlyselectivekitkinaseprimaryv559dmutantinhibitorforgastrointestinalstromaltumorsgists
AT wujiaxin discoveryofahighlyselectivekitkinaseprimaryv559dmutantinhibitorforgastrointestinalstromaltumorsgists
AT liuxiaochuan discoveryofahighlyselectivekitkinaseprimaryv559dmutantinhibitorforgastrointestinalstromaltumorsgists
AT wangaoli discoveryofahighlyselectivekitkinaseprimaryv559dmutantinhibitorforgastrointestinalstromaltumorsgists
AT wangwenliang discoveryofahighlyselectivekitkinaseprimaryv559dmutantinhibitorforgastrointestinalstromaltumorsgists
AT wangwenchao discoveryofahighlyselectivekitkinaseprimaryv559dmutantinhibitorforgastrointestinalstromaltumorsgists
AT qiziping discoveryofahighlyselectivekitkinaseprimaryv559dmutantinhibitorforgastrointestinalstromaltumorsgists
AT wangbeilei discoveryofahighlyselectivekitkinaseprimaryv559dmutantinhibitorforgastrointestinalstromaltumorsgists
AT wangli discoveryofahighlyselectivekitkinaseprimaryv559dmutantinhibitorforgastrointestinalstromaltumorsgists
AT yanhezhong discoveryofahighlyselectivekitkinaseprimaryv559dmutantinhibitorforgastrointestinalstromaltumorsgists
AT wangjiaoxue discoveryofahighlyselectivekitkinaseprimaryv559dmutantinhibitorforgastrointestinalstromaltumorsgists
AT rentao discoveryofahighlyselectivekitkinaseprimaryv559dmutantinhibitorforgastrointestinalstromaltumorsgists
AT tangjun discoveryofahighlyselectivekitkinaseprimaryv559dmutantinhibitorforgastrointestinalstromaltumorsgists
AT liuqingsong discoveryofahighlyselectivekitkinaseprimaryv559dmutantinhibitorforgastrointestinalstromaltumorsgists
AT liujing discoveryofahighlyselectivekitkinaseprimaryv559dmutantinhibitorforgastrointestinalstromaltumorsgists