Cargando…

Protosappanin A protects against atherosclerosis via anti- hyperlipidemia, anti-inflammation and NF-κB signaling pathway in hyperlipidemic rabbits

OBJECTIVE(S): Protosappanin A (PrA) is an effective and major ingredient of Caesalpinia sappan L. The current study was aimed to explore the effect of PrA on atherosclerosis (AS). MATERIALS AND METHODS: Firstly, the experimental model of AS was established in rabbits by two-month feeding of high fat...

Descripción completa

Detalles Bibliográficos
Autores principales: Huang, Ying, Qi, Yuan, Du, JianQing, Zhang, DaiFu
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Mashhad University of Medical Sciences 2018
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5776434/
https://www.ncbi.nlm.nih.gov/pubmed/29372034
http://dx.doi.org/10.22038/IJBMS.2017.18840.5029
_version_ 1783294080509280256
author Huang, Ying
Qi, Yuan
Du, JianQing
Zhang, DaiFu
author_facet Huang, Ying
Qi, Yuan
Du, JianQing
Zhang, DaiFu
author_sort Huang, Ying
collection PubMed
description OBJECTIVE(S): Protosappanin A (PrA) is an effective and major ingredient of Caesalpinia sappan L. The current study was aimed to explore the effect of PrA on atherosclerosis (AS). MATERIALS AND METHODS: Firstly, the experimental model of AS was established in rabbits by two-month feeding of high fat diet. Then, the rabbits were randomly divided into five groups and treated with continuous high lipid diet (model control), high lipid diet containing rosuvastatin (positive control), 5 mg/kg PrA (low dose) or 25 mg/kg PrA (high dose). RESULTS: Our results showed that PrA markedly alleviated AS as indicated by hematoxylin/eosin (HE) staining. PrA also reduced hyperlipidemia (as demonstrated by the serum levels of total blood cholesterol (TC), triglyceride (TG), low-density lipoprotein (LDL) and high-density lipoprotein (HDL)) in a time and dose-dependent manner, and decreased inflammation (as indicated by the serum levels of matrix metalloproteinase-9 [MMP-9], interleukin-6 [IL-6] and tumor necrosis factor-α [TNF-α]). Moreover, PrA significantly inactivated nuclear factor kappa B (NF-κB) signaling as indicated by nuclear NF-κB p65 protein expression, as well as the mRNA expression and serum levels of downstream genes, interferon-γ (IFN-γ) and interferon-gamma-inducible protein 10 (IP10). CONCLUSION: This study proved that PrA might protect against atherosclerosis via anti-hyperlipidemia, anti-inflammation and NF-κB signaling pathways in hyperlipidemic rabbits.
format Online
Article
Text
id pubmed-5776434
institution National Center for Biotechnology Information
language English
publishDate 2018
publisher Mashhad University of Medical Sciences
record_format MEDLINE/PubMed
spelling pubmed-57764342018-01-25 Protosappanin A protects against atherosclerosis via anti- hyperlipidemia, anti-inflammation and NF-κB signaling pathway in hyperlipidemic rabbits Huang, Ying Qi, Yuan Du, JianQing Zhang, DaiFu Iran J Basic Med Sci Original Article OBJECTIVE(S): Protosappanin A (PrA) is an effective and major ingredient of Caesalpinia sappan L. The current study was aimed to explore the effect of PrA on atherosclerosis (AS). MATERIALS AND METHODS: Firstly, the experimental model of AS was established in rabbits by two-month feeding of high fat diet. Then, the rabbits were randomly divided into five groups and treated with continuous high lipid diet (model control), high lipid diet containing rosuvastatin (positive control), 5 mg/kg PrA (low dose) or 25 mg/kg PrA (high dose). RESULTS: Our results showed that PrA markedly alleviated AS as indicated by hematoxylin/eosin (HE) staining. PrA also reduced hyperlipidemia (as demonstrated by the serum levels of total blood cholesterol (TC), triglyceride (TG), low-density lipoprotein (LDL) and high-density lipoprotein (HDL)) in a time and dose-dependent manner, and decreased inflammation (as indicated by the serum levels of matrix metalloproteinase-9 [MMP-9], interleukin-6 [IL-6] and tumor necrosis factor-α [TNF-α]). Moreover, PrA significantly inactivated nuclear factor kappa B (NF-κB) signaling as indicated by nuclear NF-κB p65 protein expression, as well as the mRNA expression and serum levels of downstream genes, interferon-γ (IFN-γ) and interferon-gamma-inducible protein 10 (IP10). CONCLUSION: This study proved that PrA might protect against atherosclerosis via anti-hyperlipidemia, anti-inflammation and NF-κB signaling pathways in hyperlipidemic rabbits. Mashhad University of Medical Sciences 2018-01 /pmc/articles/PMC5776434/ /pubmed/29372034 http://dx.doi.org/10.22038/IJBMS.2017.18840.5029 Text en Copyright: © Iranian Journal of Basic Medical Sciences http://creativecommons.org/licenses/by-nc-sa/3.0 This is an open-access article distributed under the terms of the Creative Commons Attribution-Noncommercial-Share Alike 3.0 Unported, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.
spellingShingle Original Article
Huang, Ying
Qi, Yuan
Du, JianQing
Zhang, DaiFu
Protosappanin A protects against atherosclerosis via anti- hyperlipidemia, anti-inflammation and NF-κB signaling pathway in hyperlipidemic rabbits
title Protosappanin A protects against atherosclerosis via anti- hyperlipidemia, anti-inflammation and NF-κB signaling pathway in hyperlipidemic rabbits
title_full Protosappanin A protects against atherosclerosis via anti- hyperlipidemia, anti-inflammation and NF-κB signaling pathway in hyperlipidemic rabbits
title_fullStr Protosappanin A protects against atherosclerosis via anti- hyperlipidemia, anti-inflammation and NF-κB signaling pathway in hyperlipidemic rabbits
title_full_unstemmed Protosappanin A protects against atherosclerosis via anti- hyperlipidemia, anti-inflammation and NF-κB signaling pathway in hyperlipidemic rabbits
title_short Protosappanin A protects against atherosclerosis via anti- hyperlipidemia, anti-inflammation and NF-κB signaling pathway in hyperlipidemic rabbits
title_sort protosappanin a protects against atherosclerosis via anti- hyperlipidemia, anti-inflammation and nf-κb signaling pathway in hyperlipidemic rabbits
topic Original Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5776434/
https://www.ncbi.nlm.nih.gov/pubmed/29372034
http://dx.doi.org/10.22038/IJBMS.2017.18840.5029
work_keys_str_mv AT huangying protosappaninaprotectsagainstatherosclerosisviaantihyperlipidemiaantiinflammationandnfkbsignalingpathwayinhyperlipidemicrabbits
AT qiyuan protosappaninaprotectsagainstatherosclerosisviaantihyperlipidemiaantiinflammationandnfkbsignalingpathwayinhyperlipidemicrabbits
AT dujianqing protosappaninaprotectsagainstatherosclerosisviaantihyperlipidemiaantiinflammationandnfkbsignalingpathwayinhyperlipidemicrabbits
AT zhangdaifu protosappaninaprotectsagainstatherosclerosisviaantihyperlipidemiaantiinflammationandnfkbsignalingpathwayinhyperlipidemicrabbits