Cargando…

MCM6 promotes metastasis of hepatocellular carcinoma via MEK/ERK pathway and serves as a novel serum biomarker for early recurrence

BACKGROUND: The high incidence of recurrence and metastasis of hepatocellular carcinoma (HCC) necessitate the discovery of new predictive biomarkers of invasion and prognosis. Minichromosome maintenance complex component 6 (MCM6), which has been reported to up-regulate in multiple malignancies, was...

Descripción completa

Detalles Bibliográficos
Autores principales: Liu, Mingyu, Hu, Qiaoting, Tu, Mengxian, Wang, Xinyi, Yang, Zike, Yang, Guoxiong, Luo, Rongcheng
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2018
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5778693/
https://www.ncbi.nlm.nih.gov/pubmed/29357919
http://dx.doi.org/10.1186/s13046-017-0669-z
_version_ 1783294404525555712
author Liu, Mingyu
Hu, Qiaoting
Tu, Mengxian
Wang, Xinyi
Yang, Zike
Yang, Guoxiong
Luo, Rongcheng
author_facet Liu, Mingyu
Hu, Qiaoting
Tu, Mengxian
Wang, Xinyi
Yang, Zike
Yang, Guoxiong
Luo, Rongcheng
author_sort Liu, Mingyu
collection PubMed
description BACKGROUND: The high incidence of recurrence and metastasis of hepatocellular carcinoma (HCC) necessitate the discovery of new predictive biomarkers of invasion and prognosis. Minichromosome maintenance complex component 6 (MCM6), which has been reported to up-regulate in multiple malignancies, was considered to be a novel diagnoses biomarker in HCC. However, its functional contributions and prognostic value remain unclear. METHODS: The expression of MCM6 was analyzed in 70 HCC tissues and 5 HCC cell lines by immunohistochemistry and real-time RT-PCR. The roles of MCM6 in HCC cell proliferation, migration and invasion were explored by CCK8, Wound healing and Transwell assays, respectively. Western blotting and Immunofluorescence staining were conducted to detect the protein expressions of ERK signaling pathway and EMT-related markers. To verify the above findings in vivo, we established subcutaneous xenograft tumor and orthotopic xenograft tumor models in nude mice. Finally, Enzyme-linked immunosorbent assay was used to evaluate the serum MCM6 level. RESULTS: MCM6 was significantly up-regulated in HCC tissues. Increased MCM6 expression was associated with aggressive clinicopathological features and worse prognosis in HCC patients. These results were consistent with our analyses of The Cancer Genome Atlas database (TCGA). Furthermore, knockdown of MCM6 significantly decreased proliferative and migratory/invasive capability of HCC cells in vitro, as well as decreased tumor volume, weight and the number of pulmonary metastases in vivo. Mechanistic analyses indicated that MCM6 promoted EMT and activated MEK/ERK signaling. More importantly, serum MCM6 levels in HCC patients were significantly higher than those in cirrhosis and healthy controls (P < 0.0001), and allowed distinguishing early recurrence with high accuracy (AUC = 0.773). CONCLUSIONS: Our findings indicate that MCM6 predicts poor prognosis and promotes metastasis in HCC. Postoperative serum MCM6 level could be valuable to detect preclinical early recurrence, indicative of a need for more careful surveillance and aggressive therapeutic intervention. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s13046-017-0669-z) contains supplementary material, which is available to authorized users.
format Online
Article
Text
id pubmed-5778693
institution National Center for Biotechnology Information
language English
publishDate 2018
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-57786932018-01-31 MCM6 promotes metastasis of hepatocellular carcinoma via MEK/ERK pathway and serves as a novel serum biomarker for early recurrence Liu, Mingyu Hu, Qiaoting Tu, Mengxian Wang, Xinyi Yang, Zike Yang, Guoxiong Luo, Rongcheng J Exp Clin Cancer Res Research BACKGROUND: The high incidence of recurrence and metastasis of hepatocellular carcinoma (HCC) necessitate the discovery of new predictive biomarkers of invasion and prognosis. Minichromosome maintenance complex component 6 (MCM6), which has been reported to up-regulate in multiple malignancies, was considered to be a novel diagnoses biomarker in HCC. However, its functional contributions and prognostic value remain unclear. METHODS: The expression of MCM6 was analyzed in 70 HCC tissues and 5 HCC cell lines by immunohistochemistry and real-time RT-PCR. The roles of MCM6 in HCC cell proliferation, migration and invasion were explored by CCK8, Wound healing and Transwell assays, respectively. Western blotting and Immunofluorescence staining were conducted to detect the protein expressions of ERK signaling pathway and EMT-related markers. To verify the above findings in vivo, we established subcutaneous xenograft tumor and orthotopic xenograft tumor models in nude mice. Finally, Enzyme-linked immunosorbent assay was used to evaluate the serum MCM6 level. RESULTS: MCM6 was significantly up-regulated in HCC tissues. Increased MCM6 expression was associated with aggressive clinicopathological features and worse prognosis in HCC patients. These results were consistent with our analyses of The Cancer Genome Atlas database (TCGA). Furthermore, knockdown of MCM6 significantly decreased proliferative and migratory/invasive capability of HCC cells in vitro, as well as decreased tumor volume, weight and the number of pulmonary metastases in vivo. Mechanistic analyses indicated that MCM6 promoted EMT and activated MEK/ERK signaling. More importantly, serum MCM6 levels in HCC patients were significantly higher than those in cirrhosis and healthy controls (P < 0.0001), and allowed distinguishing early recurrence with high accuracy (AUC = 0.773). CONCLUSIONS: Our findings indicate that MCM6 predicts poor prognosis and promotes metastasis in HCC. Postoperative serum MCM6 level could be valuable to detect preclinical early recurrence, indicative of a need for more careful surveillance and aggressive therapeutic intervention. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s13046-017-0669-z) contains supplementary material, which is available to authorized users. BioMed Central 2018-01-22 /pmc/articles/PMC5778693/ /pubmed/29357919 http://dx.doi.org/10.1186/s13046-017-0669-z Text en © The Author(s). 2018 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research
Liu, Mingyu
Hu, Qiaoting
Tu, Mengxian
Wang, Xinyi
Yang, Zike
Yang, Guoxiong
Luo, Rongcheng
MCM6 promotes metastasis of hepatocellular carcinoma via MEK/ERK pathway and serves as a novel serum biomarker for early recurrence
title MCM6 promotes metastasis of hepatocellular carcinoma via MEK/ERK pathway and serves as a novel serum biomarker for early recurrence
title_full MCM6 promotes metastasis of hepatocellular carcinoma via MEK/ERK pathway and serves as a novel serum biomarker for early recurrence
title_fullStr MCM6 promotes metastasis of hepatocellular carcinoma via MEK/ERK pathway and serves as a novel serum biomarker for early recurrence
title_full_unstemmed MCM6 promotes metastasis of hepatocellular carcinoma via MEK/ERK pathway and serves as a novel serum biomarker for early recurrence
title_short MCM6 promotes metastasis of hepatocellular carcinoma via MEK/ERK pathway and serves as a novel serum biomarker for early recurrence
title_sort mcm6 promotes metastasis of hepatocellular carcinoma via mek/erk pathway and serves as a novel serum biomarker for early recurrence
topic Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5778693/
https://www.ncbi.nlm.nih.gov/pubmed/29357919
http://dx.doi.org/10.1186/s13046-017-0669-z
work_keys_str_mv AT liumingyu mcm6promotesmetastasisofhepatocellularcarcinomaviamekerkpathwayandservesasanovelserumbiomarkerforearlyrecurrence
AT huqiaoting mcm6promotesmetastasisofhepatocellularcarcinomaviamekerkpathwayandservesasanovelserumbiomarkerforearlyrecurrence
AT tumengxian mcm6promotesmetastasisofhepatocellularcarcinomaviamekerkpathwayandservesasanovelserumbiomarkerforearlyrecurrence
AT wangxinyi mcm6promotesmetastasisofhepatocellularcarcinomaviamekerkpathwayandservesasanovelserumbiomarkerforearlyrecurrence
AT yangzike mcm6promotesmetastasisofhepatocellularcarcinomaviamekerkpathwayandservesasanovelserumbiomarkerforearlyrecurrence
AT yangguoxiong mcm6promotesmetastasisofhepatocellularcarcinomaviamekerkpathwayandservesasanovelserumbiomarkerforearlyrecurrence
AT luorongcheng mcm6promotesmetastasisofhepatocellularcarcinomaviamekerkpathwayandservesasanovelserumbiomarkerforearlyrecurrence