Use of MenACWY-CRM Vaccine in Children Aged 2 Through 23 Months at Increased Risk for Meningococcal Disease: Recommendations of the Advisory Committee on Immunization Practices, 2013

Detalles Bibliográficos
Autores principales: MacNeil, Jessica R., Rubin, Lorry, McNamara, Lucy, Briere, Elizabeth C., Clark, Thomas A., Cohn, Amanda C.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: U.S. Centers for Disease Control 2014
Materias:
Articles
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5779369/
https://www.ncbi.nlm.nih.gov/pubmed/24941332
_version_ 1783294523370110976
author MacNeil, Jessica R.
Rubin, Lorry
McNamara, Lucy
Briere, Elizabeth C.
Clark, Thomas A.
Cohn, Amanda C.
author_facet MacNeil, Jessica R.
Rubin, Lorry
McNamara, Lucy
Briere, Elizabeth C.
Clark, Thomas A.
Cohn, Amanda C.
author_sort MacNeil, Jessica R.
collection PubMed
description
format Online
Article
Text
id pubmed-5779369
institution National Center for Biotechnology Information
language English
publishDate 2014
publisher U.S. Centers for Disease Control
record_format MEDLINE/PubMed
spelling pubmed-57793692018-03-06 Use of MenACWY-CRM Vaccine in Children Aged 2 Through 23 Months at Increased Risk for Meningococcal Disease: Recommendations of the Advisory Committee on Immunization Practices, 2013 MacNeil, Jessica R. Rubin, Lorry McNamara, Lucy Briere, Elizabeth C. Clark, Thomas A. Cohn, Amanda C. MMWR Morb Mortal Wkly Rep Articles U.S. Centers for Disease Control 2014-06-20 /pmc/articles/PMC5779369/ /pubmed/24941332 Text en https://creativecommons.org/publicdomain/zero/1.0/All material in the MMWR Series is in the public domain and may be used and reprinted without permission; citation as to source, however, is appreciated.
spellingShingle Articles
MacNeil, Jessica R.
Rubin, Lorry
McNamara, Lucy
Briere, Elizabeth C.
Clark, Thomas A.
Cohn, Amanda C.
Use of MenACWY-CRM Vaccine in Children Aged 2 Through 23 Months at Increased Risk for Meningococcal Disease: Recommendations of the Advisory Committee on Immunization Practices, 2013
title Use of MenACWY-CRM Vaccine in Children Aged 2 Through 23 Months at Increased Risk for Meningococcal Disease: Recommendations of the Advisory Committee on Immunization Practices, 2013
title_full Use of MenACWY-CRM Vaccine in Children Aged 2 Through 23 Months at Increased Risk for Meningococcal Disease: Recommendations of the Advisory Committee on Immunization Practices, 2013
title_fullStr Use of MenACWY-CRM Vaccine in Children Aged 2 Through 23 Months at Increased Risk for Meningococcal Disease: Recommendations of the Advisory Committee on Immunization Practices, 2013
title_full_unstemmed Use of MenACWY-CRM Vaccine in Children Aged 2 Through 23 Months at Increased Risk for Meningococcal Disease: Recommendations of the Advisory Committee on Immunization Practices, 2013
title_short Use of MenACWY-CRM Vaccine in Children Aged 2 Through 23 Months at Increased Risk for Meningococcal Disease: Recommendations of the Advisory Committee on Immunization Practices, 2013
title_sort use of menacwy-crm vaccine in children aged 2 through 23 months at increased risk for meningococcal disease: recommendations of the advisory committee on immunization practices, 2013
topic Articles
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5779369/
https://www.ncbi.nlm.nih.gov/pubmed/24941332
work_keys_str_mv AT macneiljessicar useofmenacwycrmvaccineinchildrenaged2through23monthsatincreasedriskformeningococcaldiseaserecommendationsoftheadvisorycommitteeonimmunizationpractices2013
AT rubinlorry useofmenacwycrmvaccineinchildrenaged2through23monthsatincreasedriskformeningococcaldiseaserecommendationsoftheadvisorycommitteeonimmunizationpractices2013
AT mcnamaralucy useofmenacwycrmvaccineinchildrenaged2through23monthsatincreasedriskformeningococcaldiseaserecommendationsoftheadvisorycommitteeonimmunizationpractices2013
AT briereelizabethc useofmenacwycrmvaccineinchildrenaged2through23monthsatincreasedriskformeningococcaldiseaserecommendationsoftheadvisorycommitteeonimmunizationpractices2013
AT clarkthomasa useofmenacwycrmvaccineinchildrenaged2through23monthsatincreasedriskformeningococcaldiseaserecommendationsoftheadvisorycommitteeonimmunizationpractices2013
AT cohnamandac useofmenacwycrmvaccineinchildrenaged2through23monthsatincreasedriskformeningococcaldiseaserecommendationsoftheadvisorycommitteeonimmunizationpractices2013

Ejemplares similares