Cargando…

Sequential HER2 blockade as effective therapy in chemorefractory, HER2 gene-amplified, RAS wild-type, metastatic colorectal cancer: learning from a clinical case

BACKGROUND: Constitutive activation of HER2-dependent intracellular signalling by HER2 gene amplification or by HER2 mutations has been demonstrated as a mechanism of primary and secondary cancer resistance to cetuximab or panitumumab in preclinical and clinical models of metastatic colorectal cance...

Descripción completa

Detalles Bibliográficos
Autores principales: Martinelli, Erika, Troiani, Teresa, Sforza, Vincenzo, Martini, Giulia, Cardone, Claudia, Vitiello, Pietro Paolo, Ciardiello, Davide, Rachiglio, Anna Maria, Normanno, Nicola, Sartore-Bianchi, Andrea, Marsoni, Silvia, Bardelli, Alberto, Siena, Salvatore, Ciardiello, Fortunato
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BMJ Publishing Group 2018
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5786925/
https://www.ncbi.nlm.nih.gov/pubmed/29387480
http://dx.doi.org/10.1136/esmoopen-2017-000299
_version_ 1783295846230523904
author Martinelli, Erika
Troiani, Teresa
Sforza, Vincenzo
Martini, Giulia
Cardone, Claudia
Vitiello, Pietro Paolo
Ciardiello, Davide
Rachiglio, Anna Maria
Normanno, Nicola
Sartore-Bianchi, Andrea
Marsoni, Silvia
Bardelli, Alberto
Siena, Salvatore
Ciardiello, Fortunato
author_facet Martinelli, Erika
Troiani, Teresa
Sforza, Vincenzo
Martini, Giulia
Cardone, Claudia
Vitiello, Pietro Paolo
Ciardiello, Davide
Rachiglio, Anna Maria
Normanno, Nicola
Sartore-Bianchi, Andrea
Marsoni, Silvia
Bardelli, Alberto
Siena, Salvatore
Ciardiello, Fortunato
author_sort Martinelli, Erika
collection PubMed
description BACKGROUND: Constitutive activation of HER2-dependent intracellular signalling by HER2 gene amplification or by HER2 mutations has been demonstrated as a mechanism of primary and secondary cancer resistance to cetuximab or panitumumab in preclinical and clinical models of metastatic colorectal cancer (mCRC). Both HER2 Amplification for Colorectal Cancer Enhanced Stratification (HERACLES) cohort A and My Pathway clinical trials provided clinical evidence that anti-HER2 therapies could be active in these patients. PATIENT AND METHODS: HER2 gene amplification and HER2 protein overexpression analysis were performed in tumour tissue by fluorescence in situ hybridisation and immunohistochemistry. HER2 positivity was defined according to HERACLES CRC-specific HER2 scoring criteria. DNA analysis for multiple assessment of gene mutations or amplifications was carried out with the next-generation sequencing (NGS) Ion AmpliSeq Colon and Lung Cancer Panel and by using a more extensive targeted high-multiplex PCR-based NGS panel (OncoMine Comprehensive Assay). RESULTS: We report the clinical case of a patient with HER2 gene amplified and RAS/BRAF wild-type mCRC who experienced a long lasting and relevant clinical efficacy from sequential anti-HER2 therapies (trastuzumab plus lapatinib, pertuzumab plus trastuzumab, trastuzumab emtansine, trastuzumab plus capecitabine) achieving a cumulative clinical benefit of 29 months, after failure of the first three lines of standard treatments, which included all the potentially active drugs in mCRC, and which accounted for only 14 months of disease control. HER gene amplification was confirmed by NGS on two different metastatic lesions during the evolution of the disease. CONCLUSION: The clinical case highlights the role of HER2 gene amplification as a key genetic driver of cancer development and progression in mCRC and suggests that sequential HER2 blockade could be a potential therapeutic strategy.
format Online
Article
Text
id pubmed-5786925
institution National Center for Biotechnology Information
language English
publishDate 2018
publisher BMJ Publishing Group
record_format MEDLINE/PubMed
spelling pubmed-57869252018-01-31 Sequential HER2 blockade as effective therapy in chemorefractory, HER2 gene-amplified, RAS wild-type, metastatic colorectal cancer: learning from a clinical case Martinelli, Erika Troiani, Teresa Sforza, Vincenzo Martini, Giulia Cardone, Claudia Vitiello, Pietro Paolo Ciardiello, Davide Rachiglio, Anna Maria Normanno, Nicola Sartore-Bianchi, Andrea Marsoni, Silvia Bardelli, Alberto Siena, Salvatore Ciardiello, Fortunato ESMO Open Original Research BACKGROUND: Constitutive activation of HER2-dependent intracellular signalling by HER2 gene amplification or by HER2 mutations has been demonstrated as a mechanism of primary and secondary cancer resistance to cetuximab or panitumumab in preclinical and clinical models of metastatic colorectal cancer (mCRC). Both HER2 Amplification for Colorectal Cancer Enhanced Stratification (HERACLES) cohort A and My Pathway clinical trials provided clinical evidence that anti-HER2 therapies could be active in these patients. PATIENT AND METHODS: HER2 gene amplification and HER2 protein overexpression analysis were performed in tumour tissue by fluorescence in situ hybridisation and immunohistochemistry. HER2 positivity was defined according to HERACLES CRC-specific HER2 scoring criteria. DNA analysis for multiple assessment of gene mutations or amplifications was carried out with the next-generation sequencing (NGS) Ion AmpliSeq Colon and Lung Cancer Panel and by using a more extensive targeted high-multiplex PCR-based NGS panel (OncoMine Comprehensive Assay). RESULTS: We report the clinical case of a patient with HER2 gene amplified and RAS/BRAF wild-type mCRC who experienced a long lasting and relevant clinical efficacy from sequential anti-HER2 therapies (trastuzumab plus lapatinib, pertuzumab plus trastuzumab, trastuzumab emtansine, trastuzumab plus capecitabine) achieving a cumulative clinical benefit of 29 months, after failure of the first three lines of standard treatments, which included all the potentially active drugs in mCRC, and which accounted for only 14 months of disease control. HER gene amplification was confirmed by NGS on two different metastatic lesions during the evolution of the disease. CONCLUSION: The clinical case highlights the role of HER2 gene amplification as a key genetic driver of cancer development and progression in mCRC and suggests that sequential HER2 blockade could be a potential therapeutic strategy. BMJ Publishing Group 2018-01-10 /pmc/articles/PMC5786925/ /pubmed/29387480 http://dx.doi.org/10.1136/esmoopen-2017-000299 Text en © European Society for Medical Oncology (unless otherwise stated in the text of the article) 2018. All rights reserved. No commercial use is permitted unless otherwise expressly granted. This is an Open Access article distributed in accordance with the Creative Commons Attribution Non Commercial (CC BY-NC 4.0) license, which permits others to distribute, remix, adapt, build upon this work non-commercially, and license their derivative works on different terms, provided the original work is properly cited and the use is non-commercial. See: http://creativecommons.org/licenses/by-nc/4.0/
spellingShingle Original Research
Martinelli, Erika
Troiani, Teresa
Sforza, Vincenzo
Martini, Giulia
Cardone, Claudia
Vitiello, Pietro Paolo
Ciardiello, Davide
Rachiglio, Anna Maria
Normanno, Nicola
Sartore-Bianchi, Andrea
Marsoni, Silvia
Bardelli, Alberto
Siena, Salvatore
Ciardiello, Fortunato
Sequential HER2 blockade as effective therapy in chemorefractory, HER2 gene-amplified, RAS wild-type, metastatic colorectal cancer: learning from a clinical case
title Sequential HER2 blockade as effective therapy in chemorefractory, HER2 gene-amplified, RAS wild-type, metastatic colorectal cancer: learning from a clinical case
title_full Sequential HER2 blockade as effective therapy in chemorefractory, HER2 gene-amplified, RAS wild-type, metastatic colorectal cancer: learning from a clinical case
title_fullStr Sequential HER2 blockade as effective therapy in chemorefractory, HER2 gene-amplified, RAS wild-type, metastatic colorectal cancer: learning from a clinical case
title_full_unstemmed Sequential HER2 blockade as effective therapy in chemorefractory, HER2 gene-amplified, RAS wild-type, metastatic colorectal cancer: learning from a clinical case
title_short Sequential HER2 blockade as effective therapy in chemorefractory, HER2 gene-amplified, RAS wild-type, metastatic colorectal cancer: learning from a clinical case
title_sort sequential her2 blockade as effective therapy in chemorefractory, her2 gene-amplified, ras wild-type, metastatic colorectal cancer: learning from a clinical case
topic Original Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5786925/
https://www.ncbi.nlm.nih.gov/pubmed/29387480
http://dx.doi.org/10.1136/esmoopen-2017-000299
work_keys_str_mv AT martinellierika sequentialher2blockadeaseffectivetherapyinchemorefractoryher2geneamplifiedraswildtypemetastaticcolorectalcancerlearningfromaclinicalcase
AT troianiteresa sequentialher2blockadeaseffectivetherapyinchemorefractoryher2geneamplifiedraswildtypemetastaticcolorectalcancerlearningfromaclinicalcase
AT sforzavincenzo sequentialher2blockadeaseffectivetherapyinchemorefractoryher2geneamplifiedraswildtypemetastaticcolorectalcancerlearningfromaclinicalcase
AT martinigiulia sequentialher2blockadeaseffectivetherapyinchemorefractoryher2geneamplifiedraswildtypemetastaticcolorectalcancerlearningfromaclinicalcase
AT cardoneclaudia sequentialher2blockadeaseffectivetherapyinchemorefractoryher2geneamplifiedraswildtypemetastaticcolorectalcancerlearningfromaclinicalcase
AT vitiellopietropaolo sequentialher2blockadeaseffectivetherapyinchemorefractoryher2geneamplifiedraswildtypemetastaticcolorectalcancerlearningfromaclinicalcase
AT ciardiellodavide sequentialher2blockadeaseffectivetherapyinchemorefractoryher2geneamplifiedraswildtypemetastaticcolorectalcancerlearningfromaclinicalcase
AT rachiglioannamaria sequentialher2blockadeaseffectivetherapyinchemorefractoryher2geneamplifiedraswildtypemetastaticcolorectalcancerlearningfromaclinicalcase
AT normannonicola sequentialher2blockadeaseffectivetherapyinchemorefractoryher2geneamplifiedraswildtypemetastaticcolorectalcancerlearningfromaclinicalcase
AT sartorebianchiandrea sequentialher2blockadeaseffectivetherapyinchemorefractoryher2geneamplifiedraswildtypemetastaticcolorectalcancerlearningfromaclinicalcase
AT marsonisilvia sequentialher2blockadeaseffectivetherapyinchemorefractoryher2geneamplifiedraswildtypemetastaticcolorectalcancerlearningfromaclinicalcase
AT bardellialberto sequentialher2blockadeaseffectivetherapyinchemorefractoryher2geneamplifiedraswildtypemetastaticcolorectalcancerlearningfromaclinicalcase
AT sienasalvatore sequentialher2blockadeaseffectivetherapyinchemorefractoryher2geneamplifiedraswildtypemetastaticcolorectalcancerlearningfromaclinicalcase
AT ciardiellofortunato sequentialher2blockadeaseffectivetherapyinchemorefractoryher2geneamplifiedraswildtypemetastaticcolorectalcancerlearningfromaclinicalcase