Cargando…

Determinants of adolescent pregnancy in sub-Saharan Africa: a systematic review

BACKGROUND: Adolescent pregnancy has been persistently high in sub-Saharan Africa. The objective of this review is to identify factors influencing adolescent pregnancies in sub-Saharan Africa in order to design appropriate intervention program. METHODS: A search in MEDLINE, Scopus, Web of science, a...

Descripción completa

Detalles Bibliográficos
Autores principales: Yakubu, Ibrahim, Salisu, Waliu Jawula
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2018
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5787272/
https://www.ncbi.nlm.nih.gov/pubmed/29374479
http://dx.doi.org/10.1186/s12978-018-0460-4
_version_ 1783295901715922944
author Yakubu, Ibrahim
Salisu, Waliu Jawula
author_facet Yakubu, Ibrahim
Salisu, Waliu Jawula
author_sort Yakubu, Ibrahim
collection PubMed
description BACKGROUND: Adolescent pregnancy has been persistently high in sub-Saharan Africa. The objective of this review is to identify factors influencing adolescent pregnancies in sub-Saharan Africa in order to design appropriate intervention program. METHODS: A search in MEDLINE, Scopus, Web of science, and Google Scholar databases with the following keywords: determinants, factors, reasons, sociocultural factors, adolescent pregnancy, unintended pregnancies, and sub- Saharan Africa. Qualitative and cross-sectional studies intended to assess factors influencing adolescent pregnancies as the primary outcome variable in sub- Saharan Africa were included. Our search was limited to, articles published from the year 2000 to 2017 in English. Twenty-four (24) original articles met the inclusion criteria. RESULTS: The study identified Sociocultural, environmental and Economic factors (Peer influence, unwanted sexual advances from adult males, coercive sexual relations, unequal gender power relations, poverty, religion, early marriage, lack of parental counseling and guidance, parental neglect, absence of affordable or free education, lack of comprehensive sexuality education, non-use of contraceptives, male’s responsibility to buy condoms, early sexual debut and inappropriate forms of recreation). Individual factors (excessive use of alcohol, substance abuse, educational status, low self-esteem, and inability to resist sexual temptation, curiosity, and cell phone usage). Health service-related factors (cost of contraceptives, Inadequate and unskilled health workers, long waiting time and lack of privacy at clinics, lack of comprehensive sexuality education, misconceptions about contraceptives, and non-friendly adolescent reproductive services,) as influencing adolescent pregnancies in Sub-Saharan Africa CONCLUSION: High levels of adolescent pregnancies in Sub-Saharan Africa is attributable to multiple factors. Our study, however, categorized these factors into three major themes; sociocultural and economic, individual, and health service related factors as influencing adolescent pregnancies. Community sensitization, comprehensive sexuality education and ensuring girls enroll and stay in schools could reduce adolescent pregnancy rates. Also, provision of adolescent-friendly health services in schools and healthcare centers and initiating adolescent empowerment programs could have a positive impact.
format Online
Article
Text
id pubmed-5787272
institution National Center for Biotechnology Information
language English
publishDate 2018
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-57872722018-02-08 Determinants of adolescent pregnancy in sub-Saharan Africa: a systematic review Yakubu, Ibrahim Salisu, Waliu Jawula Reprod Health Review BACKGROUND: Adolescent pregnancy has been persistently high in sub-Saharan Africa. The objective of this review is to identify factors influencing adolescent pregnancies in sub-Saharan Africa in order to design appropriate intervention program. METHODS: A search in MEDLINE, Scopus, Web of science, and Google Scholar databases with the following keywords: determinants, factors, reasons, sociocultural factors, adolescent pregnancy, unintended pregnancies, and sub- Saharan Africa. Qualitative and cross-sectional studies intended to assess factors influencing adolescent pregnancies as the primary outcome variable in sub- Saharan Africa were included. Our search was limited to, articles published from the year 2000 to 2017 in English. Twenty-four (24) original articles met the inclusion criteria. RESULTS: The study identified Sociocultural, environmental and Economic factors (Peer influence, unwanted sexual advances from adult males, coercive sexual relations, unequal gender power relations, poverty, religion, early marriage, lack of parental counseling and guidance, parental neglect, absence of affordable or free education, lack of comprehensive sexuality education, non-use of contraceptives, male’s responsibility to buy condoms, early sexual debut and inappropriate forms of recreation). Individual factors (excessive use of alcohol, substance abuse, educational status, low self-esteem, and inability to resist sexual temptation, curiosity, and cell phone usage). Health service-related factors (cost of contraceptives, Inadequate and unskilled health workers, long waiting time and lack of privacy at clinics, lack of comprehensive sexuality education, misconceptions about contraceptives, and non-friendly adolescent reproductive services,) as influencing adolescent pregnancies in Sub-Saharan Africa CONCLUSION: High levels of adolescent pregnancies in Sub-Saharan Africa is attributable to multiple factors. Our study, however, categorized these factors into three major themes; sociocultural and economic, individual, and health service related factors as influencing adolescent pregnancies. Community sensitization, comprehensive sexuality education and ensuring girls enroll and stay in schools could reduce adolescent pregnancy rates. Also, provision of adolescent-friendly health services in schools and healthcare centers and initiating adolescent empowerment programs could have a positive impact. BioMed Central 2018-01-27 /pmc/articles/PMC5787272/ /pubmed/29374479 http://dx.doi.org/10.1186/s12978-018-0460-4 Text en © The Author(s). 2018 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Review
Yakubu, Ibrahim
Salisu, Waliu Jawula
Determinants of adolescent pregnancy in sub-Saharan Africa: a systematic review
title Determinants of adolescent pregnancy in sub-Saharan Africa: a systematic review
title_full Determinants of adolescent pregnancy in sub-Saharan Africa: a systematic review
title_fullStr Determinants of adolescent pregnancy in sub-Saharan Africa: a systematic review
title_full_unstemmed Determinants of adolescent pregnancy in sub-Saharan Africa: a systematic review
title_short Determinants of adolescent pregnancy in sub-Saharan Africa: a systematic review
title_sort determinants of adolescent pregnancy in sub-saharan africa: a systematic review
topic Review
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5787272/
https://www.ncbi.nlm.nih.gov/pubmed/29374479
http://dx.doi.org/10.1186/s12978-018-0460-4
work_keys_str_mv AT yakubuibrahim determinantsofadolescentpregnancyinsubsaharanafricaasystematicreview
AT salisuwaliujawula determinantsofadolescentpregnancyinsubsaharanafricaasystematicreview